KEGG   Agrobacterium radiobacter: Arad_8185Help
Entry
Arad_8185         CDS       T00850                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Arad_8185 (glpK)
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Arad_8185 (glpK)
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Arad_8185 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1036977..1038443
Genome map
AA seq 488 aa AA seqDB search
MRAILAIDQGTTNSKAILVSETGELISRGAAPVGISYPQSGWVEQDPNRIWQSVCEAVRL
CIEAAPQVTIEAVAVSNQRESVTIWDGETGEALGPVVSWQCRRTAPDCARLIEGGHSHRV
EQITGLPIDPMFPGSKVKWLLDRAPAGRSIRVGTVDSWLIHRLSGGRRHVCDASNAARSQ
LFDLKSQQWSDELCDLFGVAKQVLPEVLDSSGDFGTTANVPGVRDGTPIRAAIGDSHAAL
FGHGAYKAGDGKVTFGTGSSVMTTLPGFIAPSNGITTTVAWRIAGKPTFAFEGNILVSAA
SLPWMTDVLGLPDVAALIDLASTAEPGGPGFVPAFVGLGAPHWNSDARALFSQIGFNTTR
AQMARAVTDSIAFQVHDVFAAMQSQNGGTIGALYVDGGPSKNTFLMQCVADLLQHLVIQC
EAPEASALGAAYLAGLSLGMWPDLEAIARLPRSNTVIRPQAIISSEKLNTWSDAIARSTF
GPPPANDE
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatcctggcaatcgatcagggtaccaccaactccaaggccattttggtatcg
gagacaggcgagctgatctcgcgtggcgctgctccggtcggcatcagctatcctcaatcc
ggctgggtcgagcaggatcccaatcggatctggcagtccgtctgcgaggccgtgcgcctc
tgtatcgaagcggcgccacaggtcacgatcgaagccgtcgcggtgtccaaccagcgggag
tcggtgacgatctgggacggcgaaaccggagaggctctcggccccgtcgtcagctggcag
tgccgccggacggcaccggattgtgcaaggttgatcgagggcggtcattcgcatcgggtc
gagcagatcaccggtcttcccatcgacccgatgtttccgggctcgaaggtgaagtggctg
cttgatcgtgccccggcaggccgttcgatccgggtcggcaccgtggacagctggctgatc
caccgcctgtccggtggcaggcggcatgtatgcgatgcctccaacgccgcgcgaagccag
cttttcgaccttaagtcgcagcaatggagcgacgagctttgcgacttgttcggcgtcgcc
aagcaggtattgccggaggtgctggacagttccggggatttcggaacgactgcgaatgtg
cctggcgtgcgcgatggtacgccgatccgtgcggcaatcggcgacagccacgctgctctt
ttcgggcatggagcctacaaagccggcgatggaaaggtgacgttcggaaccggatcatcc
gtcatgaccacgctgccgggtttcatcgccccgagcaacgggattaccaccacagtcgcc
tggcgcattgccggcaaaccgacatttgccttcgagggaaacatcctcgtctcggctgcc
agcctgccatggatgacggatgtgctcggactgccggatgttgccgcattgatcgacctg
gcatcgacggcagaacccggcggacccggcttcgtgccggccttcgtcggccttggcgcg
cctcattggaattccgatgcgcgtgccctgttctctcagatcggcttcaacacgacacgc
gcgcagatggccagggccgtgacggactcgatcgcctttcaggttcatgatgtctttgcg
gcgatgcaaagccaaaatggcgggacgatcggtgcgctttatgtcgatggcggccccagt
aagaatacgtttctgatgcagtgcgttgcggatctgttgcagcatttggtcattcaatgc
gaagccccggaagcatcagccttgggagcggcctatctggccggtctgtcgctcggcatg
tggccggatctggaggctattgcgcgtctgccgcgcagcaatacggtcataagaccgcaa
gcgattatttcgtcggagaaacttaatacgtggagcgatgccattgcccgctcgacgttc
ggcccgccgcccgctaatgatgaataa

DBGET integrated database retrieval system