KEGG   Agrobacterium radiobacter K84: Arad_8317Help
Entry
Arad_8317         CDS       T00850                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ara00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ara00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ara00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1159597..1161687
Genome map
AA seq 696 aa AA seqDB search
MSKTVVIKAGAVSLALGLPVSGMPEILGFGRGALAPEFWPDVPRSSRVNGMDIAVPSNVL
LPVGGLGFFGWPAISGHRDGHSFILEFGNWQAEEIASGVILKAEDPVAEIGLRICIEASP
AEVLSISTSLTNLGSGDYTLDRCMAASFLMPAGAAELTTFTGMWGREFQTRHTAIADGLW
MQESRRGRTSHDRFPFAFLECGGERMGFHLGWSGNHLMAIDTLDDERRLVHLGELFEPGE
IRLATGETYASPTAFAGPDSEAFHAFVRESVIAWPGGEMKPRPVTLNTWEGNYCDHRMDS
LKAQADAAAAVGIERFVLDDGWFGKRDDDTTSLGDWFIDERKYPDGLKPLVDHVTSLGME
FGLWFEPENVNPESELFRAHPDWALQVEGRPLLLSRNQLVLDLTRPEVSDYLFRCMEAVL
SQHAIAYIKWDMNRDLTHAGGADGRARTAQQTRAVYALMDRIRQAFPAVEIESCASGGGR
IDYGVLRHTHRVWTSDCTDAFERLEIQHGASRFVPPELLGAHIAASPNHQTGRRLTLSFR
ALVALAYHLGVELNPLALDAEEKQELEGWIALHKSLRPLLHAPGKQFRLPPLDGRYVWGA
ADESRIVAFVAQGPQMVGEQPAPVRLPVSGEGAGKWRVKAIHPAEPEFIRISEGQQRLLN
GELTFSLDTLRHVGLPLPMLRPESGLLLEFEPVTGD
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactgttgttatcaaagccggcgcggtgtcgctggcgctcggcctgcctgta
agcggcatgccggagattctcggcttcggtcgcggagcgcttgcgccggaattctggcct
gacgttccgcgttcgagccgtgtcaacggcatggatatcgctgtgccgtcgaatgttctg
ctgcctgtcggcgggctcggcttcttcggctggccggcgatctcagggcaccgcgacggg
cactcgttcatcctggaattcggaaactggcaggccgaggaaatcgcttccggtgtcatt
ctgaaggctgaggaccctgtcgcagagatcggcctgcggatatgcatcgaggcgagcccc
gccgaggtgctgtcgatttcgacatcgttgaccaatcttggttccggcgattacaccctc
gaccgatgcatggcggcgagcttcctgatgcccgccggtgcggcggagctgaccaccttc
acaggcatgtggggtcgcgaattccagactcgccatacggcaattgccgacgggctctgg
atgcaggaaagccggcgcgggcgcacctcgcatgaccgcttccccttcgctttcctcgaa
tgcggtggcgagcggatgggcttccatctcggctggagcggcaatcacctgatggcgatc
gatacgcttgatgacgagcgccggctggtgcatctcggcgagctcttcgaaccaggcgaa
atacgtctggcaaccggcgaaacctatgctagcccgacagcctttgccgggcctgacagt
gaagctttccatgccttcgtgcgagagagcgtaattgcttggccgggcggcgagatgaag
ccccggccggtgacgctgaacacctgggaaggcaattactgcgatcaccgcatggactct
ctcaaggcccaggccgatgcggcggcggctgtcggcatcgagcgcttcgtcctcgatgac
ggttggttcggcaagcgcgacgacgataccaccagcctcggcgactggttcatcgacgag
cggaaatatcccgacgggcttaagccgctcgtcgaccatgtgacttcccttggcatggaa
ttcgggctctggttcgagcccgagaatgtaaatcccgaatccgagctctttcgcgcccat
cccgattgggctctgcaggtcgaagggcgtccgctgcttttgtcgagaaatcagctggtg
ctggatctgacgcggccggaggtcagcgactatctcttcagatgcatggaagccgtgctt
tcccagcatgcgatcgcctatatcaaatgggacatgaaccgcgacctgacccatgcaggc
ggcgcggatggccgtgctcggaccgcgcagcagacgcgggcggtctatgccctgatggat
aggatccggcaggcgtttccggccgtcgagatcgaaagctgcgcatcgggcggcgggcgt
atcgattatggtgttctccgacacacgcaccgcgtctggacctccgattgcaccgatgcc
ttcgaacggcttgagatacagcatggggcctcgcggttcgttccgccggaacttctcggc
gcgcacatcgccgcttcgccgaaccatcagaccggccgcaggctgacgctttccttccgg
gcgctcgtcgcgctcgcctatcatctgggtgtcgaactcaacccgctggccctcgatgcc
gaggagaagcaggagcttgaaggctggatcgcgcttcataagagcctgcgtccgctcctg
catgcgcctggcaagcaatttcgcctgccgccgctcgacggccgttacgtctggggtgct
gcggacgagagccgtatcgtggctttcgtcgcgcagggtccgcaaatggttggcgagcag
ccggcgccggttcgcctgccggtgagcggtgaaggtgctggcaagtggcgtgtgaaggcg
atccatcccgccgagcccgagttcatccggatatcggaaggacaacagcggcttctgaac
ggcgaactgaccttcagtctcgatacgctccggcatgtcggcttgccgctgccgatgctt
cggcccgaaagcgggcttcttcttgaattcgaaccagtgacgggagactaa

DBGET integrated database retrieval system