KEGG   Agrobacterium radiobacter K84: Arad_8320Help
Entry
Arad_8320         CDS       T00850                                 

Gene name
lacZ1
Definition
beta-D-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ara00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1162784..1164718
Genome map
AA seq 644 aa AA seqDB search
MLGVCYYPEHWPESWWEKDARRMRALGISHVRIGEFAWSRLEPTRGSFDFGWLDRAIDTL
AAAGLKVVLGTPTATPPKWLMDEYPEIAPVDEQGRVRGFGSRRHYTFSSDVWWKESERIV
EVVAKRYGEHPGIVGWQTDNEYGCHDTSLSWGAEDLKAFRRWLRLRYQSAQQLNEAWGSV
FWSMEVQSFEDVVLPNLTVTETNPAVRLDFWRFHSDQIAAYDRMQCDIIRKHSPNRWITH
NFMGFVNDFDHWKVAENLDLASWDSYPIGFVEKFPFSEEERVRWAETSHPDIAAFHHDLY
RGVGNGRFWIMEQQPGPVNWAPWNPVPKPGMVRLWSWEGLAHGAEVVSYFRWRQAPFAQE
QMHAGLNLPGLDELSPGGKEAEIVGREIETVGPLPEAAQAPVAIVYDYESYWSAVIQPQG
KDFRYEELAFRWYEAVRKLGLDVDFVRPGQSLKGYKLVLVPCLMHVSDVALAAFEQADGT
VLFGPRTGSRDRHFRIPANLPPGPIGDLTGVRVTQVASLRPGLRASLAGAVNGQATRWRE
HIETQSDATVVATFEDGAPALVSKGRYLYLACWADGALLGNLMSYLASSLDLSTTAIPDF
IRLRRAGKLTFAFNYGPDAWTIPGEQDFVLGEQEIAPFSLSAWK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcttggcgtttgctattatccggaacattggcccgagagctggtgggaaaaagacgcg
cgtcgcatgcgggcgcttggcatttctcatgtccgcatcggcgagttcgcctggtcgcgt
cttgagccgacgcgcggctccttcgatttcggctggctcgaccgggcgatcgacacgctg
gcggccgccggtctaaaggtcgtgctcggcacgccgaccgccacgccgccgaagtggctg
atggacgaatatccggagatcgctccggtggatgagcagggcagggtgcggggcttcggc
tcgcgccgtcattacactttctcatcggacgtctggtggaaggagtcggaacgtatcgtc
gaggtcgtcgcgaagcgatatggtgagcatcccggtattgtcggctggcagaccgacaat
gaatatggatgccacgataccagcctttcctggggcgccgaagatctgaaggcgtttcgc
cgctggcttcgcctccgctatcagtcggcgcagcaattgaacgaggcctggggcagcgtc
ttctggtcgatggaggtccagagcttcgaggatgtcgtgctgccgaatttgacggtgacg
gaaacgaaccccgccgtccggctcgatttctggcgcttccattccgaccagatcgccgcc
tatgaccgcatgcagtgcgatatcatccgaaagcactctccaaaccgttggatcacccat
aatttcatgggcttcgtcaacgatttcgatcattggaaggttgccgagaacctggatctg
gcctcctgggattcctatccgatcggctttgtcgagaagtttcccttcagcgaggaagag
cgcgtgcgctgggcggagacatcccaccccgacatcgccgcttttcatcacgatctctat
cgcggcgtcggcaatggccggttctggatcatggagcagcagccggggcctgtgaactgg
gcgccatggaacccggtgcccaagccgggcatggtgcgcctgtggagctgggaaggtctt
gctcatggggccgaggtcgtcagctatttccgctggcgtcaggcgccgttcgcgcaggag
cagatgcatgccggcctgaacctgcccggtctcgacgaactctcgccgggaggcaaggaa
gccgaaatcgtcgggcgtgagatcgagaccgtcggtccgttgccggaagccgctcaggcc
cccgtcgcaatcgtctacgactatgaaagctactggtccgccgtcattcagccgcagggc
aaggattttcgctatgaagagctcgccttccgctggtacgaggcggtcaggaagctcggg
ctcgacgtcgatttcgtccgtccgggtcagtcgctgaaaggctacaagcttgttctcgtt
ccctgcctgatgcatgtctccgatgtggctctggccgcgttcgaacaggctgatgggacc
gtgcttttcggtccgcggaccggatcgcgggaccgccacttccgcattccggccaatctt
ccgccgggaccgatcggcgacctcaccggtgtcagggtcacgcaggtcgcgtccttgcgg
ccggggctccgcgcctcgttggccggtgcggtcaacggtcaggcgacaagatggcgcgaa
catatcgagacgcagtcggatgcgactgtcgtggcgaccttcgaagacggcgctccggcg
ctggtgtcgaagggccgttatctctacctcgcctgctgggcggacggtgcactcctcggt
aatctgatgtcctacctcgcgtccagcctcgacctgtcaaccacggcgatacccgatttc
atccgtcttcgccgcgccggcaagctgacattcgcgttcaattacgggccggatgcgtgg
acaattcccggagagcaggatttcgtgctcggcgagcaggagatcgctccgttctctctt
tcagcctggaaatag

DBGET integrated database retrieval system