KEGG   Agrobacterium radiobacter: Arad_9044Help
Entry
Arad_9044         CDS       T00850                                 

Gene name
lacZ1
Definition
beta-D-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ara  Agrobacterium radiobacter
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arad_9044 (lacZ1)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Arad_9044 (lacZ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1768594..1770759)
Genome map
AA seq 721 aa AA seqDB search
MILQEPDTVSVNTSTKDLSVWRTIKTDRFLVGTPHYPEHVDESYWERDAERMAEAGFNVV
RLGEFAWHIFEPKLGTFDFDLFDRAIAVLARHGISTIMCTPTATPPRWLTAAHPEVLRVD
GNGRTMSHGSRQHADTASPVFREHSKRITKAMAEHYRDNPDVIGWQTDNELNTSMPESFS
AATLKEFQAYLADKYGTIDKLNFAWGGDFWATAYDDFGQVVLPIDFGPTFPSPGHLQDYH
RFLAFSTARFQHDQVEILRATKADWFIFHNLGGLRDIDFRGQFSTDLDFVGYDIYPMLYD
EFQRIGNHAKVQALHLDICRGFSGNYIIPEQQSGFGSQPGFCTLTPEPGEMRRMAMSSVA
RGADGLMFFRWRPAHFGAEIYWMGIIDHDDVPRHRYDEAKRFATEMTALKDKLLGTHVRM
DVGIAGSDFDNQEAHKTYSIGLPSPQDDAVLLHQYCYDRGIACGFIHPEDDLSRLKLLYV
PHWVMWKDGWTERLEAFARGGGTVIIGARTGTRDENNHVIREAAPGSSLTRLTGVTVEDF
GRLAAPGANGLFDVMSRSGGLMIPPNRPAESHRRVRRFTIGNRELEGAHFYENLAVADDV
EVVATWSNRYAEGVPMATSRKVGKGRVLYLGTYLTADLTAALADRTFTDAGVEPLIADLP
DGVEVTMRQNDERHLLFVQNYTDQHAELTNVPHGVNLLDGGKSVSGALLLEAYGCAIVEL
G
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatccttcaggagcctgataccgtgtcagtcaataccagcaccaaagacctttccgta
tggcgcaccatcaagaccgacaggtttctcgtcggcacgccgcattatccggaacatgtc
gatgaaagctattgggagcgcgatgccgagcgcatggccgaagccggcttcaatgtcgtc
cgtctcggcgagttcgcctggcatatcttcgagccgaagctcggaaccttcgatttcgat
ctcttcgatcgcgccatcgcggtccttgcgcgccacggcatcagcaccatcatgtgcacg
ccgaccgcaacaccgccacgctggctgacggcggcccatccggaagtccttcgcgtcgat
ggcaacggccggacgatgagccatggctcgcgccagcatgccgatacggcaagccctgtc
ttccgcgagcacagcaagcgcatcaccaaggcaatggccgagcactatcgcgacaaccct
gatgtcatcggctggcagacggacaacgaactcaacaccagcatgccggaatccttttct
gccgccacgctgaaggaattccaagcctatctcgccgacaaatacggcacgatcgacaag
ctcaatttcgcctggggcggcgatttctgggcgactgcttatgatgatttcggccaggtg
gttcttcccatcgatttcggaccgactttcccgagcccggggcatctgcaggattaccac
cgcttcctggctttctcgacggcgcgtttccagcacgatcaggtggaaatcctgcgtgca
accaaggccgattggttcatcttccacaatcttggcggcctgcgcgatatcgactttcgc
ggccagttctccaccgacctcgatttcgtcggctacgatatttatccgatgctctatgac
gagtttcagcgcatcggcaaccacgccaaggtgcaggccctgcatctcgacatctgccgc
ggcttttcgggcaactacatcatcccggaacaacaatccggcttcggcagccagcccggc
ttctgcacgctgacaccggagcccggtgagatgcgccgcatggcgatgtcctcggttgcg
cgcggcgccgatggcctgatgttctttcgctggcggccggcgcatttcggtgctgaaatc
tactggatgggcatcatcgaccatgacgacgtgccgcgtcaccgctatgacgaggcaaag
cgcttcgccaccgagatgacggcactgaaggacaagctcctcggcacccatgtccgcatg
gacgtcggcattgccggttccgacttcgacaatcaggaggcacacaagacctactcgatc
ggcctgccgagtccgcaggacgacgccgtgctgttgcaccaatattgctacgatcgcggt
atcgcctgcggcttcatccatccggaagacgatctttcgcggttgaagctgctctatgtt
ccgcattgggtaatgtggaaggatggctggaccgagcggctggaagcatttgcgcggggt
gggggcactgtgattatcggcgcgcgcaccggcacgcgcgatgaaaacaaccacgtcatc
cgcgaagcggcgccgggttcgtcgctgacgcgactgaccggcgtcaccgtcgaggatttc
ggccggctggcagcacccggcgccaatggtcttttcgatgttatgtcgcgctcaggcggg
ctgatgatcccgcccaatcgtccggccgaatcccatcgccgcgttcgccgtttcaccatc
ggcaaccgcgagctggaaggcgctcatttctatgagaacctggcggtcgccgacgatgtc
gaggtggtggcgacctggtcgaaccgctatgccgaaggcgtgccgatggcaacgtcgcgc
aaggtcggcaagggcagggtgctctatctcggcacgtacctgaccgccgatctgacggca
gcgctggccgaccgcaccttcacggatgcaggcgtcgaaccgctgatcgccgatctgccg
gatggcgtcgaagtgacgatgcgccagaacgatgaaaggcatcttctgttcgtccagaac
tacacagaccagcacgcggaactgaccaacgtcccgcacggcgtcaatctcctcgacggc
ggcaaatcggtgtccggagcattgttgctcgaagcctatggctgcgcgatcgtcgagttg
gggtga

DBGET integrated database retrieval system