KEGG   Agrobacterium radiobacter: Arad_9475Help
Entry
Arad_9475         CDS       T00850                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arad_9475
   01230 Biosynthesis of amino acids
    Arad_9475
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_9475
  Energy metabolism
   00680 Methane metabolism
    Arad_9475
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arad_9475
Enzymes [BR:ara01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Arad_9475
Exosome [BR:ara04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Arad_9475
  Exosomal proteins of melanoma cells
   Arad_9475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2154999..2155745)
Genome map
AA seq 248 aa AA seqDB search
MRIFLVRHGESLGNISDQAYRQFGDHNVPLTQWGYRQALEAGRVIASYLEGLPATELQKQ
SIWYSPYLRTRQSKDALLEALPNTLVEDIREDYLLREQDFGLFTEIYDHAEQKRKFPEEF
EKWARLRNNSGKFYARPPDGESRADVAQRVRLFLQTVMHDAKNGRDNVIIVGHGVTNRAF
EMNFLHHSVDWFERSDNPGNADVTLIEGSLKDGYTSILLHKAVDRIAGQNELREAYGSEL
TVAPKAGQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctttctcgttcgacacggcgaatcccttggcaacatcagcgaccaggcctac
cggcagttcggtgatcacaatgttccgttgacgcagtggggctatcggcaggcgctggag
gcagggcgggtgatcgcgtcctatctcgagggactgccggctactgaattgcagaagcag
agcatctggtactcgccctatctcaggacgcgacagagcaaggatgccctgctggaagcc
ttgccgaacacattggtcgaggatatccgcgaggattacctgttgcgggaacaggatttc
ggcctctttaccgaaatctatgatcatgccgaacagaaacggaagtttcccgaagagttc
gaaaaatgggccagactgcgtaataatagcggaaagttctacgcacggccgccggacggc
gagagccgggccgatgtggcgcagcgggtccgtctgttccttcagaccgtcatgcacgac
gcgaagaacggcagggacaatgtcattatcgtcggtcacggcgttaccaacagggcgttc
gaaatgaatttcctgcaccattccgtcgactggttcgaacgctcggacaatcccggaaat
gccgatgtcaccttgatcgagggaagcctcaaggacggctatacgtcaatcctgctccac
aaggcggttgatcggatcgcggggcagaatgaattgcgcgaagcctatgggtctgagctg
acagtggcgccgaaggctgggcaatag

DBGET integrated database retrieval system