KEGG   Agrobacterium radiobacter K84: Arad_9511Help
Entry
Arad_9511         CDS       T00850                                 

Gene name
speB2
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ara00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2178330..2179379)
Genome map
AA seq 349 aa AA seqDB search
MRSGGDICISLHRRETELERYGHPHTTPFFTLNTEISAKPSPRPSKMITSPSFLGLHDRL
ADGRVPRAIIFAAGHGSTYPGKDSSGYVLAAGAIRAASQDDVALVDHWDFDLGGPLFDGK
PVCCTDAGDIETTMHDNAGNRARIEAKTREVLALPAVPILLGGDCSVTIPFAAGFADHGP
VWILQIDAHIDWRDEVHGERHGYSSPMRRASEMPHVAGIVQVGLRSVGSARLTDIEAAQH
YGSRFVTAREVHTQGVEAALRHIPEGAQVVVTLDCDSLDPSMMPGVAARTPGGLTYTQVI
DLIAGLGRRARIAGFDLVELYPPADIDGLSALTAARLLVNVIGAVVRQV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcggaggtgatatctgtatttcgctccatcgacgtgaaacggaattggaaaga
tatgggcatccacacacgaccccattcttcaccctcaataccgaaatttcagctaaacca
tcaccaagaccatcaaaaatgatcacctctccttcctttctcggccttcacgatcgcctt
gccgatggccgcgtgccccgcgcgataatcttcgcagccggtcacggtagcacctatcct
ggtaaggacagtagcggctatgtcctggcggccggcgccattcgcgctgcgagccaggac
gatgttgcactcgtagatcattgggatttcgatcttggcggcccactgttcgacggcaag
ccggtctgctgcaccgacgccggtgacatcgagaccaccatgcatgacaatgccggcaat
cgggctcggatcgaggcgaagacgcgggaggtcctggcattgccggccgtaccgatcctg
ctcggtggcgactgttccgtaaccattcccttcgccgccgggtttgcggatcacgggccg
gtctggatcctgcagattgacgcccatatcgactggcgcgacgaggtgcatggcgagcgc
cacggttattcgagcccgatgcgacgtgcgagcgagatgccccatgtcgccggcatcgtg
caggtcggcctccgtagcgtcggcagcgcgcgcctaaccgatatcgaagcggcgcagcac
tatggcagccgtttcgtgactgctcgcgaagttcatacccaaggcgttgaagccgcactc
cggcatattcccgagggcgcgcaggtcgtcgtcactctcgactgtgatagcctcgatccc
agcatgatgccgggcgtggcggcgcggacacccggcggtctcacctatacgcaggtgatc
gacttgattgcaggcctcggcaggcgagccaggatagcaggatttgaccttgtcgagctc
tatcctcctgccgacattgacggcctctcggctctgaccgccgcgcgccttctcgtcaat
gtgattggcgccgtcgtccggcaggtttga

DBGET integrated database retrieval system