KEGG   Agrobacterium radiobacter: Arad_9538Help
Entry
Arad_9538         CDS       T00850                                 

Gene name
agaL2
Definition
alpha-galactosidase (melibiase) protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ara  Agrobacterium radiobacter
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arad_9538 (agaL2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Arad_9538 (agaL2)
   00600 Sphingolipid metabolism
    Arad_9538 (agaL2)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Arad_9538 (agaL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2205663..2207033)
Genome map
AA seq 456 aa AA seqDB search
MTGNPKITFIGAGSTVFMKNIIGDVLQRPALSGARFALMDKNPERLEESAIVVRKLASTL
GAPATVETFTDQRKALDGAHFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLAVCPEAVMLQYVNPMAINTWAIAEKYPTIKQVGLCHSVQGTA
MELANDLDIPYNEIRYRSAGINHMAFYLKFEHRQPDGSYRDLYPDLVRGYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGREDLIEKFGIPLDEYPKRCIEQ
IARWKNQAEEYRSADKIEVTQSKEYASSIINSVWTGEPSVIYGNVRNNGCITSLPFNCAA
EVPCLVDASGIQPTFIGDLPPQLTALIRTNINVQELTVQALMTENREHIYHAAMMDPHTA
AELDLDQIWSLTDDLLAAHGDWLPEWARGARKVQAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaatcccaagatcacctttatcggcgccggttccaccgtcttcatgaagaac
atcatcggcgatgttttgcagcgtccggcgctttccggtgcaagattcgcgctgatggat
aaaaacccggagcggctggaagaaagcgccatcgtcgtgcgcaagcttgcctcgacgctt
ggcgcaccagccacggtcgaaacctttaccgatcagcgcaaggcgctggacggcgcccat
ttcgtcgtcgtcgccttccagatcggcggttatgagccctgcacggtgaccgatttcgaa
gtgccgaagaaatacggcctgcgccagacgattgccgatacgctcggcgtcggtggcatc
atgcgcggtctgcgcaccgtgccgcatctctggaagatctgcgaggatatgctcgcggtc
tgccctgaggcggtgatgctgcaatatgtcaacccgatggcgatcaacacctgggcgatc
gccgagaagtaccccacgatcaagcaggtcggcctttgccactcggtacagggcacggcg
atggaattggccaacgatctcgatattccctacaacgaaatccgctaccgctcggccggc
atcaaccatatggccttctacctgaaattcgagcatcgccagccggatgggtcctaccgc
gacctctatccggatctcgtgcgtggctatcgcgagggacgtgcgccaaaacccggctgg
aacccgcgctgcccgaataaggtgcgctatgaaatgttgacccggcttggctatttcgtc
acggagagctcggagcattttgccgaatacacgccctatttcatcaaggagggccgcgag
gacctgatcgagaaattcggcattccactcgatgaatatccgaagcgctgcatcgagcag
atcgcgcgctggaagaaccaagccgaggaatatcgcagtgccgacaagatcgaggtcacg
caatcgaaggaatacgcctcctcgatcatcaactcggtttggaccggcgagccctcggtc
atctacggcaatgtccgcaacaatggctgcatcacctcgctgccctttaattgcgcggcc
gaggttccttgcctggtcgatgcctcgggcatccagccgaccttcatcggcgatctgccg
ccgcaactgaccgcgctcatccgcaccaacataaatgtgcaggaattgacggttcaggcc
ttgatgactgagaaccgtgagcacatttaccacgcggcaatgatggacccgcatacggcc
gccgagctcgatctcgatcagatttggtcgcttaccgacgatctgctggccgcgcacggc
gactggttgccggaatgggcgcggggcgcccgcaaggttcaggccgcctga

DBGET integrated database retrieval system