KEGG   Agrobacterium radiobacter K84: Arad_9538Help
Entry
Arad_9538         CDS       T00850                                 

Gene name
agaL2
Definition
alpha-galactosidase (melibiase) protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ara00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ara00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ara00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2205663..2207033)
Genome map
AA seq 456 aa AA seqDB search
MTGNPKITFIGAGSTVFMKNIIGDVLQRPALSGARFALMDKNPERLEESAIVVRKLASTL
GAPATVETFTDQRKALDGAHFVVVAFQIGGYEPCTVTDFEVPKKYGLRQTIADTLGVGGI
MRGLRTVPHLWKICEDMLAVCPEAVMLQYVNPMAINTWAIAEKYPTIKQVGLCHSVQGTA
MELANDLDIPYNEIRYRSAGINHMAFYLKFEHRQPDGSYRDLYPDLVRGYREGRAPKPGW
NPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFIKEGREDLIEKFGIPLDEYPKRCIEQ
IARWKNQAEEYRSADKIEVTQSKEYASSIINSVWTGEPSVIYGNVRNNGCITSLPFNCAA
EVPCLVDASGIQPTFIGDLPPQLTALIRTNINVQELTVQALMTENREHIYHAAMMDPHTA
AELDLDQIWSLTDDLLAAHGDWLPEWARGARKVQAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcaatcccaagatcacctttatcggcgccggttccaccgtcttcatgaagaac
atcatcggcgatgttttgcagcgtccggcgctttccggtgcaagattcgcgctgatggat
aaaaacccggagcggctggaagaaagcgccatcgtcgtgcgcaagcttgcctcgacgctt
ggcgcaccagccacggtcgaaacctttaccgatcagcgcaaggcgctggacggcgcccat
ttcgtcgtcgtcgccttccagatcggcggttatgagccctgcacggtgaccgatttcgaa
gtgccgaagaaatacggcctgcgccagacgattgccgatacgctcggcgtcggtggcatc
atgcgcggtctgcgcaccgtgccgcatctctggaagatctgcgaggatatgctcgcggtc
tgccctgaggcggtgatgctgcaatatgtcaacccgatggcgatcaacacctgggcgatc
gccgagaagtaccccacgatcaagcaggtcggcctttgccactcggtacagggcacggcg
atggaattggccaacgatctcgatattccctacaacgaaatccgctaccgctcggccggc
atcaaccatatggccttctacctgaaattcgagcatcgccagccggatgggtcctaccgc
gacctctatccggatctcgtgcgtggctatcgcgagggacgtgcgccaaaacccggctgg
aacccgcgctgcccgaataaggtgcgctatgaaatgttgacccggcttggctatttcgtc
acggagagctcggagcattttgccgaatacacgccctatttcatcaaggagggccgcgag
gacctgatcgagaaattcggcattccactcgatgaatatccgaagcgctgcatcgagcag
atcgcgcgctggaagaaccaagccgaggaatatcgcagtgccgacaagatcgaggtcacg
caatcgaaggaatacgcctcctcgatcatcaactcggtttggaccggcgagccctcggtc
atctacggcaatgtccgcaacaatggctgcatcacctcgctgccctttaattgcgcggcc
gaggttccttgcctggtcgatgcctcgggcatccagccgaccttcatcggcgatctgccg
ccgcaactgaccgcgctcatccgcaccaacataaatgtgcaggaattgacggttcaggcc
ttgatgactgagaaccgtgagcacatttaccacgcggcaatgatggacccgcatacggcc
gccgagctcgatctcgatcagatttggtcgcttaccgacgatctgctggccgcgcacggc
gactggttgccggaatgggcgcggggcgcccgcaaggttcaggccgcctga

DBGET integrated database retrieval system