KEGG   Agrobacterium radiobacter: Arad_9545Help
Entry
Arad_9545         CDS       T00850                                 

Gene name
agaL1
Definition
alpha-galactosidase (melibiase) protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ara  Agrobacterium radiobacter
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arad_9545 (agaL1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Arad_9545 (agaL1)
   00600 Sphingolipid metabolism
    Arad_9545 (agaL1)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Arad_9545 (agaL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2213252..2214718)
Genome map
AA seq 488 aa AA seqDB search
MSFKIAIIGAGSVGFTKKLFTDILCVPEFQDVEFALTDVSEHNLSMIKSILDRIVESNKL
PTRVTATTERRKAISGARYVISCVRVGGLEAYAEDIRIPLKYGIDQCVGDTICAGGILYG
QRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTIGLCHGVQHGAEQI
AEVLGAKNKSELDYICSGINHQTWFTDLRFNGRKIGKDELVAAFEAHPVFSQQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEINKWIDMSDWIHGETGGYLRHSTETRNWFETE
FQQILDSASQPIDPARRSNEHASHILEALETNRVYRGHFNVKNNGVITNLPADAIIESPG
FVDRFGINMVAGITLPEACAATCISSINVQRMSVHAAISGDLDLLKLAVLHDPLVGAVST
PEEVWQMVDEMVVAEARWLPQYAHAVEGAKDRLSRAKVKTRDWKGAASRNVRSIEELRAE
KAALKQAG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaaatcgccattatcggcgcaggcagcgtcggcttcacgaaaaagctgttc
accgacattctatgcgtgccggagttccaggacgtcgaattcgcgttgaccgatgtcagc
gagcataatctctcgatgatcaagtcgatcctcgaccggatcgtagaatcgaataagttg
ccgacgcgggtaacggccaccaccgaacgccgtaaggcgatctccggtgcacgctacgtc
attagctgcgtgcgggtcggcgggctggaagcctatgccgaggatatccgtattcccctg
aaatacggtatcgaccaatgcgtcggcgatacgatctgcgccggcggcatcctttatggc
cagcgcaacattccggtcattctcgatttctgcaaggatatccgcgaggtcgccgagccc
ggcgcaaagttcctgaactatgccaacccgatggcgatgaacacctgggcggcgatcgaa
tacggcaaggtcgacacgatcggcctttgccacggcgtccagcatggcgcggagcagatt
gcggaggtgcttggcgcgaagaacaagtcggagctcgactatatttgctcgggcatcaac
caccagacctggttcaccgatcttcgcttcaacgggcgcaagattggcaaggacgaactg
gtcgccgccttcgaggcgcatccggtgttctcgcagcaggaaaagctgcgcatcgacgtg
ctgaagcgcttcggggtctactccaccgaaagcaacggccatctatccgaatacctgccc
tggtatcgcaagcggccggacgagatcaacaagtggatcgacatgtccgactggatccat
ggcgagacgggcggttatctgcgccattccactgagacccgcaactggttcgagacggaa
ttccagcagatcctcgacagtgcgtcgcagcccatcgacccggccaggcgctcgaatgaa
catgcaagccatattctcgaggcattggagaccaatcgcgtctatcgcggccacttcaac
gtcaagaacaacggggtcatcaccaatctgccggccgatgccatcatcgagtcacccggc
ttcgtcgatcggttcggcatcaacatggtcgccggcatcacgctgccggaggcctgcgcc
gccacctgcatttcctcgatcaatgtccagcgcatgtcggtgcatgccgccattagcggc
gatctcgacctgttgaagctcgccgttctgcatgatccactggtcggcgccgtctcgacg
ccggaagaagtctggcagatggttgacgaaatggtcgtcgcggaagcacgctggttgccg
caatatgcccatgccgtcgagggtgccaaggatcgcctgtcgcgggccaaggtgaagacc
cgtgactggaagggtgcggccagccgcaacgtccgctcgatcgaggagttgagagcggag
aaggcggctttgaaacaggccggttaa

DBGET integrated database retrieval system