KEGG   Agrobacterium radiobacter: Arad_9548Help
Entry
Arad_9548         CDS       T00850                                 

Gene name
lacZ2
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ara  Agrobacterium radiobacter
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arad_9548 (lacZ2)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Arad_9548 (lacZ2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arad_9548 (lacZ2)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Arad_9548 (lacZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2216121..2218364
Genome map
AA seq 747 aa AA seqDB search
MRSVVAFNESWTFHEGFSAADAGSRQEGQPIALPHSAVELPFNYFDEKSYQRAFTYQKIL
PWSDDFAGREVSLVFDAAMADAVVYLNGEEIVAHQDGYTPFEARLTGRLKQGDNLITVKI
DGSENPEIPPFGGRIDYLTYAGIYRDVWLKLAAPVSIANIKVETSNVLDDSKSATVRCDI
TNPQSLAFNGMVTANLRAPDGKALASATSETSGDSVSFSFDNLSGISLWDLDTPVLYTLE
AELKTDHGSDRYSTTFGFRTAAFTDEGFLLNGRKLKLRGLNRHQAFPYSGYAMGRSAQER
DAEIMKQTLKCNVVRTSHYPQSKWFLDHCDRIGLLVFEEIPGWQHIGGKEWQQESIRNVR
RMIERDWNHPSIIIWGVRINESQDSHDFYAETNRLARELDHTRQTGGVRYITESEMLEDV
YTMNDFILGNEELPGANRPRTPLRPQQENTGLSKNVPYLITEFGGHMYPTKIYDQEQRQA
EHVRRHLEVLNAAYGDPSISGAIGWCMFDYNTHSDFGSGDRICYHGVMDMFREPKFAAYA
YASQCEPSEEVIMKPVTIWARGERNIGGALPLIVLTNCDEVELRYGSLTKRLGPDRESFP
HLPHPPVIFDHRNFTQDELGVWGMEWEDARFTGYVNGKPVAELHMVANPLPTRLEVQADS
LTLRADERDTTRVIIRALDQAGTRLPFLNDVAMIKVSGPAKLIGPEAVAFQGGTTGFWLQ
ATGKAGAITVAVSSARFAGQTIELKAE
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgttgtcgctttcaacgaatcctggacttttcacgaaggcttttcagccgct
gacgccggcagccgccaggaaggacagccgatcgcattgccgcactcggcggtcgaactg
ccgttcaactatttcgatgagaaatcctatcagcgcgccttcacttatcagaaaatcctg
ccctggagcgacgacttcgccgggcgcgaggtatcgctggtattcgacgccgccatggcc
gacgcggtggtttatctcaacggcgaggaaatcgtcgcgcatcaggatggctacacgccc
ttcgaggcacggctgacggggcgcctgaagcaaggcgataacctgatcaccgtcaagatc
gatggtagcgaaaaccccgagatcccgccgttcggcggccgcatcgactatctcacctat
gccggcatctaccgcgacgtctggctcaagcttgcagcacccgtctctatcgccaatatc
aaggtcgagaccagcaacgtactggacgatagtaaatccgcgacggtgcgctgcgatatc
accaacccgcaaagcctcgccttcaatggtatggtgaccgcaaacctccgcgcgccggac
ggcaaggcgctggcgtccgcgaccagcgagacctcgggcgacagcgtgagcttctccttc
gacaatctctccggcatctcactgtgggacctcgacactcccgtactctacacgctggaa
gctgagctgaagaccgatcacggctccgaccgatattcaacaacattcggtttccgcacc
gccgcgttcaccgatgaaggtttcctgttgaacggccgcaagctgaagctgcgcggtctc
aaccgtcatcaggccttcccctattccggctatgccatgggccgctcggcgcaggagcgt
gatgccgagatcatgaagcagacgttgaagtgcaatgtcgtacgcacctcgcattatccg
caatcgaaatggttcctcgaccattgcgaccgtatcggcctgctggtcttcgaggaaatc
cccggctggcagcatatcggcggcaaggaatggcagcaggaatcaatccgcaacgtccgc
cgcatgatcgagcgcgactggaaccatccgtctatcatcatctggggcgtgcgtatcaac
gagtcgcaggattcgcatgatttctacgccgagaccaaccggctggcgcgcgagctcgat
cacacccgccagaccggcggcgtgcgctacattaccgagagcgaaatgcttgaggacgtc
tacacgatgaacgacttcatcctcggcaacgaggaactgccgggcgccaatcgcccacgc
acgccgctgcggccacagcaggaaaataccggcctgtcgaagaacgtgccctacctgatc
accgaattcggcggccacatgtatccgacgaagatctacgatcaggagcagcgccaggcc
gagcatgtgcgccggcatctggaagtgctgaacgcggcctatggcgacccctcgatctcc
ggtgccatcggctggtgcatgttcgactacaacacgcatagcgacttcggctccggcgac
cgcatctgctatcacggcgtcatggacatgttccgcgagccgaaattcgcggcctatgcc
tatgccagccagtgcgagccttccgaggaggtcatcatgaagccggtaacgatctgggcg
cgcggcgagcgcaatatcggcggcgcgctgccgctgatcgtgctgaccaattgcgacgag
gtcgaactgcgctacggttcgctcaccaagcgcctcggccccgatcgcgagagcttcccg
catttgccgcacccgcccgtcattttcgatcatcgcaatttcacccaggacgaactcggc
gtctggggcatggaatgggaagacgcgcgcttcaccggttacgtcaatggcaagccggtc
gcggaactgcatatggtcgccaatccgctgccgacgaggctggaggtgcaggccgacagc
ctgacgctgcgtgccgacgagcgcgacacgacccgcgtcattatccgcgcgctcgaccag
gccggcacccgcctgcccttcctcaacgacgtcgcaatgatcaaggtcagcggtccggcg
aaactgatcgggccggaagctgtggccttccagggcggcacaacgggtttctggctgcag
gcaaccggcaaggccggtgcgatcacggtcgcagtgtcctcagcacgttttgcgggccag
accattgagctgaaggcggaataa

DBGET integrated database retrieval system