KEGG   Agrobacterium radiobacter K84: Arad_9548Help
Entry
Arad_9548         CDS       T00850                                 

Gene name
lacZ2
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ara00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ara00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ara00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2216121..2218364
Genome map
AA seq 747 aa AA seqDB search
MRSVVAFNESWTFHEGFSAADAGSRQEGQPIALPHSAVELPFNYFDEKSYQRAFTYQKIL
PWSDDFAGREVSLVFDAAMADAVVYLNGEEIVAHQDGYTPFEARLTGRLKQGDNLITVKI
DGSENPEIPPFGGRIDYLTYAGIYRDVWLKLAAPVSIANIKVETSNVLDDSKSATVRCDI
TNPQSLAFNGMVTANLRAPDGKALASATSETSGDSVSFSFDNLSGISLWDLDTPVLYTLE
AELKTDHGSDRYSTTFGFRTAAFTDEGFLLNGRKLKLRGLNRHQAFPYSGYAMGRSAQER
DAEIMKQTLKCNVVRTSHYPQSKWFLDHCDRIGLLVFEEIPGWQHIGGKEWQQESIRNVR
RMIERDWNHPSIIIWGVRINESQDSHDFYAETNRLARELDHTRQTGGVRYITESEMLEDV
YTMNDFILGNEELPGANRPRTPLRPQQENTGLSKNVPYLITEFGGHMYPTKIYDQEQRQA
EHVRRHLEVLNAAYGDPSISGAIGWCMFDYNTHSDFGSGDRICYHGVMDMFREPKFAAYA
YASQCEPSEEVIMKPVTIWARGERNIGGALPLIVLTNCDEVELRYGSLTKRLGPDRESFP
HLPHPPVIFDHRNFTQDELGVWGMEWEDARFTGYVNGKPVAELHMVANPLPTRLEVQADS
LTLRADERDTTRVIIRALDQAGTRLPFLNDVAMIKVSGPAKLIGPEAVAFQGGTTGFWLQ
ATGKAGAITVAVSSARFAGQTIELKAE
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcgttctgttgtcgctttcaacgaatcctggacttttcacgaaggcttttcagccgct
gacgccggcagccgccaggaaggacagccgatcgcattgccgcactcggcggtcgaactg
ccgttcaactatttcgatgagaaatcctatcagcgcgccttcacttatcagaaaatcctg
ccctggagcgacgacttcgccgggcgcgaggtatcgctggtattcgacgccgccatggcc
gacgcggtggtttatctcaacggcgaggaaatcgtcgcgcatcaggatggctacacgccc
ttcgaggcacggctgacggggcgcctgaagcaaggcgataacctgatcaccgtcaagatc
gatggtagcgaaaaccccgagatcccgccgttcggcggccgcatcgactatctcacctat
gccggcatctaccgcgacgtctggctcaagcttgcagcacccgtctctatcgccaatatc
aaggtcgagaccagcaacgtactggacgatagtaaatccgcgacggtgcgctgcgatatc
accaacccgcaaagcctcgccttcaatggtatggtgaccgcaaacctccgcgcgccggac
ggcaaggcgctggcgtccgcgaccagcgagacctcgggcgacagcgtgagcttctccttc
gacaatctctccggcatctcactgtgggacctcgacactcccgtactctacacgctggaa
gctgagctgaagaccgatcacggctccgaccgatattcaacaacattcggtttccgcacc
gccgcgttcaccgatgaaggtttcctgttgaacggccgcaagctgaagctgcgcggtctc
aaccgtcatcaggccttcccctattccggctatgccatgggccgctcggcgcaggagcgt
gatgccgagatcatgaagcagacgttgaagtgcaatgtcgtacgcacctcgcattatccg
caatcgaaatggttcctcgaccattgcgaccgtatcggcctgctggtcttcgaggaaatc
cccggctggcagcatatcggcggcaaggaatggcagcaggaatcaatccgcaacgtccgc
cgcatgatcgagcgcgactggaaccatccgtctatcatcatctggggcgtgcgtatcaac
gagtcgcaggattcgcatgatttctacgccgagaccaaccggctggcgcgcgagctcgat
cacacccgccagaccggcggcgtgcgctacattaccgagagcgaaatgcttgaggacgtc
tacacgatgaacgacttcatcctcggcaacgaggaactgccgggcgccaatcgcccacgc
acgccgctgcggccacagcaggaaaataccggcctgtcgaagaacgtgccctacctgatc
accgaattcggcggccacatgtatccgacgaagatctacgatcaggagcagcgccaggcc
gagcatgtgcgccggcatctggaagtgctgaacgcggcctatggcgacccctcgatctcc
ggtgccatcggctggtgcatgttcgactacaacacgcatagcgacttcggctccggcgac
cgcatctgctatcacggcgtcatggacatgttccgcgagccgaaattcgcggcctatgcc
tatgccagccagtgcgagccttccgaggaggtcatcatgaagccggtaacgatctgggcg
cgcggcgagcgcaatatcggcggcgcgctgccgctgatcgtgctgaccaattgcgacgag
gtcgaactgcgctacggttcgctcaccaagcgcctcggccccgatcgcgagagcttcccg
catttgccgcacccgcccgtcattttcgatcatcgcaatttcacccaggacgaactcggc
gtctggggcatggaatgggaagacgcgcgcttcaccggttacgtcaatggcaagccggtc
gcggaactgcatatggtcgccaatccgctgccgacgaggctggaggtgcaggccgacagc
ctgacgctgcgtgccgacgagcgcgacacgacccgcgtcattatccgcgcgctcgaccag
gccggcacccgcctgcccttcctcaacgacgtcgcaatgatcaaggtcagcggtccggcg
aaactgatcgggccggaagctgtggccttccagggcggcacaacgggtttctggctgcag
gcaaccggcaaggccggtgcgatcacggtcgcagtgtcctcagcacgttttgcgggccag
accattgagctgaaggcggaataa

DBGET integrated database retrieval system