KEGG   Agrobacterium radiobacter: Arad_9577Help
Entry
Arad_9577         CDS       T00850                                 

Gene name
exoN
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ara  Agrobacterium radiobacter
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Arad_9577 (exoN)
   00052 Galactose metabolism
    Arad_9577 (exoN)
   00500 Starch and sucrose metabolism
    Arad_9577 (exoN)
   00520 Amino sugar and nucleotide sugar metabolism
    Arad_9577 (exoN)
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Arad_9577 (exoN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2244982..2245887
Genome map
AA seq 301 aa AA seqDB search
MDRKLPVRKAVIPVAGNGTRFLPATKAMPKEMLTIVDRPVVQYAVDEAIEAGIEHIVFVT
SRNKTSIEDHFDDTPELISSLNRAGKTKQVSELERLLPRAGSVSFTRQQSPLGLGHAVWC
ARDVIGNEPFALLLPDMVCHGVRGCTAGLMDLYNEVGGNVVGVEECSPEETSSYGIIGRG
APVRHGFGVTKMVEKPHPSEAPSNFYLNGRYILQPEIFDILARQERGAGNEIQLTDGMLR
LSETQGFHAQAYNGRTYDCGSKQGFIEANVAFALARADIGGLVYDSIRSLVLSHEAQMNA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtaagcttcctgtgagaaaagcagtcattccggttgccggcaacggaacccgt
ttcctgcccgccacaaaggcaatgccgaaggaaatgctgacgatcgtcgatcgtccggtg
gtgcagtatgccgtcgatgaagccatcgaagccggcatcgagcacatcgttttcgtcacc
agccgcaacaagacgtcgatcgaagaccacttcgacgacacgccggagctgatttcctcg
ctgaacagggcaggcaagacgaagcaggtgtccgaactggagcgccttctgccgcgcgcc
ggctccgtcagcttcacccgccagcagtcgccgctcggtctcggccatgccgtctggtgc
gcccgcgatgtgatcggcaacgaacccttcgcgctgcttttgcctgacatggtctgccat
ggcgtgcgcggctgcaccgccgggttgatggatctctataacgaagtcggcggcaatgtc
gtcggtgtcgaggaatgctcacctgaagaaacgtcgagctacggcattatcggcagggga
gcgccggttcgccatggcttcggcgtgaccaaaatggttgaaaagccgcatccttcggag
gcgccttccaacttttaccttaatggtcgctatattctgcagcccgaaatcttcgatatt
ctggcccggcaagagcgcggcgccggtaacgagatccaactcaccgacggcatgctgcgc
ctgtctgaaacacaggggttccatgctcaagcctataatggacggacttacgattgcgga
tcgaagcaaggcttcatcgaggcgaacgtcgccttcgcgctcgcgcgtgccgatattggc
ggtctcgtctatgactcgatccgaagcctggttctctcgcacgaagcgcagatgaacgca
gcttaa

DBGET integrated database retrieval system