KEGG   Agrobacterium radiobacter: Arad_9619Help
Entry
Arad_9619         CDS       T00850                                 

Definition
(GenBank) transcriptional regulator protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00010  Glycolysis / Gluconeogenesis
ara00052  Galactose metabolism
ara00500  Starch and sucrose metabolism
ara00520  Amino sugar and nucleotide sugar metabolism
ara00521  Streptomycin biosynthesis
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01200  Carbon metabolism
Module
ara_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_9619
   00052 Galactose metabolism
    Arad_9619
   00500 Starch and sucrose metabolism
    Arad_9619
   00520 Amino sugar and nucleotide sugar metabolism
    Arad_9619
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arad_9619
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Arad_9619
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arad_9619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK AAA_33 IPT BcrAD_BadFG CPT AAA_18 AAA_16 Hydin_ADK Zeta_toxin KTI12 FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACM30623
UniProt: B9JL31
Position
2:complement(2282585..2283997)
Genome map
AA seq 470 aa AA seqDB search
MPETAIGVDIGGTNIRAALVSDRGEILKKLSDRTPTDPLHVVERVVAMVGELDATGAAGI
GVGIPGRVDAASRTILSGGILNLAGIDFADRLETRLGKRVVIENDCNMALIAEMRIGGAK
GYQSVAMLTIGTGIGGAVAHNGSIYHGHMTAGQLGHISVLRDGPLCACGRRGCVETFSSG
TALRRHMNEAGLSATSIGEIFEMAAEGNGTARAVLRAWASPLRTALDNIAATMDPDVILL
GGGLGCDAARALADLPAVAPWFRPTILPAKLGDDAGVIGAALSTFANAGNSAEKRVVLVN
GVPASGKSRLAKSLSQRTGWPVLSLDGIKNPFLEHIGPVDRDFNRTLGKASYQAIWSFIR
EAPAGSTFIVDAWFGFQPKALLETYIKDAGVDRVAELWCKVPGAVAAERYASRLKDRLPG
HPGAEYVAELAVLADHAEPMACGALRTVEQTKEPDMDSITAWISEMFDQA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagacagccatcggcgtggacattggcggcacgaatattcgtgccgctctcgtc
tccgatcgaggcgagattctgaagaagctatcggatcggacacccaccgatccgttgcat
gtggtcgagcgcgtcgtggcgatggtcggtgaactcgatgcgacgggagcagccggcatc
ggtgtcggcattcccggtcgtgtcgatgcggccagccgcacgatcctctcgggcggtatc
ctcaatctggccggcatcgattttgccgatcggcttgagacgcgcctcggcaagcgggtc
gtcatcgaaaatgattgcaacatggcgctcatcgccgaaatgcgtattggcggcgccaag
ggatatcagagtgtcgcgatgctgacgatcggaacgggcatcggcggtgccgtcgcccat
aatggcagcatctatcacggccatatgacggccgggcagctgggccatatctccgtgctg
cgggatggcccgctttgcgcgtgcggacggcgcggctgcgtggaaaccttcagctcggga
acggcgctgcgtcggcatatgaacgaagccggcctttcggccacgtccatcggcgaaatt
ttcgaaatggcggccgagggaaatggcacggcgagggcggtcttgcgtgcatgggcatcc
ccgctgcgcaccgccctcgataatatcgcggcaacaatggatccggacgtcattttgttg
ggaggggggctcggctgcgacgcggcgcgtgcccttgccgaccttccagcggtggcgcca
tggttccggccgacgatcctgcccgcgaagcttggggacgacgccggcgtaatcggcgcg
gccttgtcgacattcgcgaatgctggcaattccgccgaaaaacgcgtcgtgctcgtcaac
ggcgttccggcttcgggaaagagccggcttgcaaaatcgctatcacaacgtaccggttgg
ccggttctttctctcgatggcatcaagaatccatttctggagcacatcggccccgtcgac
cgggatttcaatcggactttgggaaaggcgagctaccaggcgatctggtcgttcatccgc
gaggcgccggctgggtccactttcatcgtcgatgcatggttcggtttccagccgaaggca
ctgcttgagacctatatcaaggatgccggtgtggatcgcgtcgcggagctttggtgcaag
gtgcccggtgcggttgcggcggaacgctatgccagccgtttgaaagaccggctgccgggc
catccgggtgccgaatatgtcgccgaactcgcggtgcttgccgatcacgcggagcccatg
gcatgcggcgctctgaggacggtcgaacagacgaaagagccggatatggacagtataacc
gcctggatttcagagatgtttgaccaggcatga

DBGET integrated database retrieval system