KEGG   Agrobacterium radiobacter: Arad_9619Help
Entry
Arad_9619         CDS       T00850                                 

Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arad_9619
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_9619
   00052 Galactose metabolism
    Arad_9619
   00500 Starch and sucrose metabolism
    Arad_9619
   00520 Amino sugar and nucleotide sugar metabolism
    Arad_9619
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arad_9619
   00524 Butirosin and neomycin biosynthesis
    Arad_9619
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arad_9619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2282585..2283997)
Genome map
AA seq 470 aa AA seqDB search
MPETAIGVDIGGTNIRAALVSDRGEILKKLSDRTPTDPLHVVERVVAMVGELDATGAAGI
GVGIPGRVDAASRTILSGGILNLAGIDFADRLETRLGKRVVIENDCNMALIAEMRIGGAK
GYQSVAMLTIGTGIGGAVAHNGSIYHGHMTAGQLGHISVLRDGPLCACGRRGCVETFSSG
TALRRHMNEAGLSATSIGEIFEMAAEGNGTARAVLRAWASPLRTALDNIAATMDPDVILL
GGGLGCDAARALADLPAVAPWFRPTILPAKLGDDAGVIGAALSTFANAGNSAEKRVVLVN
GVPASGKSRLAKSLSQRTGWPVLSLDGIKNPFLEHIGPVDRDFNRTLGKASYQAIWSFIR
EAPAGSTFIVDAWFGFQPKALLETYIKDAGVDRVAELWCKVPGAVAAERYASRLKDRLPG
HPGAEYVAELAVLADHAEPMACGALRTVEQTKEPDMDSITAWISEMFDQA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagacagccatcggcgtggacattggcggcacgaatattcgtgccgctctcgtc
tccgatcgaggcgagattctgaagaagctatcggatcggacacccaccgatccgttgcat
gtggtcgagcgcgtcgtggcgatggtcggtgaactcgatgcgacgggagcagccggcatc
ggtgtcggcattcccggtcgtgtcgatgcggccagccgcacgatcctctcgggcggtatc
ctcaatctggccggcatcgattttgccgatcggcttgagacgcgcctcggcaagcgggtc
gtcatcgaaaatgattgcaacatggcgctcatcgccgaaatgcgtattggcggcgccaag
ggatatcagagtgtcgcgatgctgacgatcggaacgggcatcggcggtgccgtcgcccat
aatggcagcatctatcacggccatatgacggccgggcagctgggccatatctccgtgctg
cgggatggcccgctttgcgcgtgcggacggcgcggctgcgtggaaaccttcagctcggga
acggcgctgcgtcggcatatgaacgaagccggcctttcggccacgtccatcggcgaaatt
ttcgaaatggcggccgagggaaatggcacggcgagggcggtcttgcgtgcatgggcatcc
ccgctgcgcaccgccctcgataatatcgcggcaacaatggatccggacgtcattttgttg
ggaggggggctcggctgcgacgcggcgcgtgcccttgccgaccttccagcggtggcgcca
tggttccggccgacgatcctgcccgcgaagcttggggacgacgccggcgtaatcggcgcg
gccttgtcgacattcgcgaatgctggcaattccgccgaaaaacgcgtcgtgctcgtcaac
ggcgttccggcttcgggaaagagccggcttgcaaaatcgctatcacaacgtaccggttgg
ccggttctttctctcgatggcatcaagaatccatttctggagcacatcggccccgtcgac
cgggatttcaatcggactttgggaaaggcgagctaccaggcgatctggtcgttcatccgc
gaggcgccggctgggtccactttcatcgtcgatgcatggttcggtttccagccgaaggca
ctgcttgagacctatatcaaggatgccggtgtggatcgcgtcgcggagctttggtgcaag
gtgcccggtgcggttgcggcggaacgctatgccagccgtttgaaagaccggctgccgggc
catccgggtgccgaatatgtcgccgaactcgcggtgcttgccgatcacgcggagcccatg
gcatgcggcgctctgaggacggtcgaacagacgaaagagccggatatggacagtataacc
gcctggatttcagagatgtttgaccaggcatga

DBGET integrated database retrieval system