KEGG   Agrobacterium radiobacter: Arad_9637Help
Entry
Arad_9637         CDS       T00850                                 

Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arad_9637
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arad_9637
   00052 Galactose metabolism
    Arad_9637
   00500 Starch and sucrose metabolism
    Arad_9637
   00520 Amino sugar and nucleotide sugar metabolism
    Arad_9637
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arad_9637
   00524 Butirosin and neomycin biosynthesis
    Arad_9637
Enzymes [BR:ara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arad_9637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2300096..2301133
Genome map
AA seq 345 aa AA seqDB search
MKKVALAFDLGGTELRAALVDEEGNLLSFSAVPTQAAEGPDAVVRQIEVLAATVLAKTPD
LLPIGIGIGAPGPLDPEAGVVIAAPTLTGWNEVPLADILSSRFQLPVRLENDANAAAVGE
WRYGAGRGARSIVFVTVSTGIGGGVIADSRILHGRRGLAAEIGHMTITNEGERCFCGAVG
CFEAVASGTALGRQATARTRRSDGSMLRKLSANADVTGRHVVDAARNGDALALELLNAEA
RWLGIGFTNLLHLYSPDVLVMGGGISHGFDLLHDTIMATICDRAMPAYRDVPIVAAQLGR
HAGLIGAASLILGSEAQASSEPSSLVGSGNPDADISAGTKEASNG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaggtcgctcttgccttcgatctcggcggaaccgagcttcgcgccgcactggtg
gacgaggagggaaaccttctgtcgttttccgccgtgccgacgcaagcagccgaaggccct
gatgcggtggtccggcaaatcgaggtgctggcagcgacggtgctggcgaaaacgcctgat
cttctgcccatcggcatcgggatcggtgcccccggccctctcgatccggaggctggcgtc
gtcattgcggcgccgaccctgaccggatggaacgaggttcccctcgctgatattctttcc
agccgtttccaattgccggtgcggcttgaaaacgatgcgaacgcggcggcggttggcgaa
tggcgatatggcgccggccgtggtgcaagatcgatcgtgttcgtcaccgtctcgaccggc
atcggcggcggcgtgattgccgatagccgaattttgcacggtagacgtggtctggcagcg
gaaatcggccacatgacgattaccaacgagggtgaacgatgcttttgcggcgcagtcggc
tgctttgaggccgtcgcctccggcacggcgctcggcaggcaggcaacggctcgcacccgg
cgatctgatggctcgatgctgcgaaagctttcagccaacgccgatgtaaccggacggcat
gtggtcgacgcggcgcgaaacggcgatgccctggcgctggaactgctgaatgccgaggcg
cgatggctcgggatcggcttcaccaacctgctccacctctactcacccgatgttctggtg
atgggcggcggcatatcccatgggttcgatcttcttcacgacaccatcatggcgacaatc
tgcgaccgggccatgccggcctatcgcgatgtgccgatcgttgccgcacagcttgggcga
catgcgggcctgatcggtgcggccagcctcattctcggaagcgaggcgcaagccagctct
gaaccatcgagccttgtcggctcgggcaatcctgacgcggatatttccgccggcacaaag
gaggccagcaatggctaa

DBGET integrated database retrieval system