KEGG   Agrobacterium radiobacter: Arad_9897Help
Entry
Arad_9897         CDS       T00850                                 

Gene name
pcm1
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ara  Agrobacterium radiobacter
Brite
Enzymes [BR:ara01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Arad_9897 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2529970..2530836
Genome map
AA seq 288 aa AA seqDB search
MTPDELKIVRRAYAKQITAAVQVVDERVETAFAEVPREDFLGPGPWPIFRMRKTYVPTPT
ADPVYLYTDDIVGIVPERHINNGQPSLHAFLLSQAAPRSGEHIVHIGAGVGYYSAIMANL
VATSGVVTAIEFEPELAARAKANLTAHRNVSVVQGDGSSVAFNSADVIYVNAGATHPADI
WLDRLNDGGRLVLPLSTDLGFTSSNWSNMHLRGAVFLVTRRGEEFHAQWISPVAIFPCEG
MRDTESEKALAAALESGEHKRVTRLYRTDEVPAEQCWVRGPGWCLAYA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggacgaattgaagatcgtgcgtcgagcttatgcgaagcagatcacagcggct
gttcaagttgtagatgagcgcgtggaaacagcctttgccgaagtgccgcgagaagatttc
cttggtcccggtccgtggccgatcttccgaatgcgaaaaacatatgttccaaccccgacc
gccgatccggtctacctttatacggatgacatcgttggcatcgtccccgagcggcacatc
aacaacgggcaaccgtcacttcatgcattcctgctttcgcaggctgcgccgcggtctggc
gagcatatcgtgcatattggcgctggtgttgggtactattctgcgatcatggcgaacctc
gttgccacatccggcgtggtgacggcgatcgagttcgagccggagcttgctgcgcgagcg
aaagcaaatctcaccgcgcatcggaacgtttccgtggttcaaggagatggtagttcggtg
gctttcaattcggccgatgtgatctatgtgaacgctggagcaactcacccggcggatatc
tggctggaccggctcaatgatggcggcaggctggtccttccgctttcaaccgatcttggt
tttaccagcagcaattggagcaacatgcaccttcgcggggcagtgttcctcgtgacgcgt
aggggtgaagaatttcacgcgcaatggatttcaccggtggctatcttcccctgtgaagga
atgcgcgatacggaatcggaaaaagcgcttgcggcggcactcgagagcggggagcacaag
agggtgacgcggctgtatcgtactgatgaggtgccggccgagcaatgttgggttcgcggt
cccggctggtgcctcgcctacgcttag

DBGET integrated database retrieval system