KEGG   Arcobacter sp. L: ABLL_0132Help
Entry
ABLL_0132         CDS       T01834                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
arc  Arcobacter sp. L
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABLL_0132
Enzymes [BR:arc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     ABLL_0132
Peptidases [BR:arc01002]
 Cysteine Peptidases
  Family C44
   ABLL_0132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
118667..120457
Genome map
AA seq 596 aa AA seqDB search
MCGIIGTNFLSPRFDKSLELLHHRGPDFQNSIKIGNKQFGHTRLAIIDLDEEANQPMIFD
DILLVFNGEIYNYKELIHVEHLECKTKSDSEVLIRLYQKYGFDFLNKLNGMFSFCIYDMK
KDLYFCARDRYGKKPFFYYFKDNKFIFSSSVKSILNLLDYKPNLNKVALSKYMQYFVSFG
EDSFYQDIFKLEASTYLIYESNKSRELQKKKYYKINTYKAIKDEKQALNDIEELLFKSVE
YRLNSDVEVASLLSGGIDSSLISALYTKISGKKINTFSIGYDEYKNYCELDFAQITAKHI
NSNHHPVEINQKEYINHFEQTLDMLEEPHGDSAAIPLNILTKQIHKAGIKTVLSGEGSDE
IFLGYDNYAKFLKYYEFEKSLSNEQNLFLNDIIGALQNNTKESEYLRRIVKKQNLYNSFG
EIYTDIQRKRLFKKVPTYKSETAKQDPVDWMSYIDLKIWLGESLLSKVDRISMGNSLEVR
TPFLDFNLVNYMFSVESSIKVGDTNKYLLKKIASKYIPDTIINRTKKGFNSPFNEWLNKE
YKDKILDVIVEVNNQTNLFNHEYILHIYELSKSNKFKQHLYSLFVFSLWYKKEFLS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattattggaacaaattttttatcacctagatttgataaatctttagaactt
ttacatcatagaggtccagactttcaaaattcaataaaaattggaaataaacaatttggt
catacaagacttgcaataattgatttagatgaagaagcaaatcaacctatgatttttgat
gatattttacttgtttttaatggtgaaatttataattataaagaattgattcacgtggaa
catttagagtgtaaaacaaaaagtgatagtgaagtattaattcgactttatcaaaagtat
ggatttgattttttaaataaactaaatggaatgttttctttttgtatttatgatatgaaa
aaagatttatatttttgtgcacgagatagatatggtaaaaaaccatttttttactatttt
aaagataacaaatttatcttttcatcaagtgtaaaatcaattttaaatctacttgattat
aaaccaaatcttaataaagttgctctatctaaatatatgcaatattttgtatcttttggt
gaagattcattctatcaagatatttttaaacttgaagcttctacatatcttatttacgag
tcaaataaaagccgtgagcttcaaaagaagaaatactataagataaacacctataaagct
ataaaagatgaaaaacaagctttaaatgatattgaggagcttttatttaaaagtgttgaa
tatagattaaatagtgatgttgaagttgcttcacttttaagtggtggaattgatagttct
ttaatctctgcactttatacaaaaatttcaggaaaaaaaattaatacctttagtattggt
tatgatgaatataaaaattattgtgaactagattttgcacaaattactgcaaaacatata
aactcaaatcatcatccagtagaaataaatcaaaaagagtatatcaatcattttgagcaa
acacttgatatgcttgaagaacctcatggagatagtgcagcaattcctttaaatatctta
acaaaacagatacataaagctggaattaaaactgtattatctggtgaaggaagtgatgag
atatttttaggttatgataactatgcaaagtttttaaaatattatgagtttgaaaaaagt
ttatcaaatgaacaaaatctttttttaaatgatatcattggagctttacaaaacaatact
aaagagagtgagtatttaagaagaattgtaaaaaaacaaaatctttataactcttttgga
gaaatttatacagatattcaaagaaaaagattattcaaaaaagttccaacatataaaagt
gaaacagcaaaacaagatccagttgattggatgagttatattgatttaaaaatatggctt
ggtgagtcacttttatcaaaagttgatagaatatctatgggaaattctttagaagtgcga
actccatttttagattttaatttagtaaattatatgtttagtgtagaatcatctatcaaa
gttggcgatacaaataaatatctcttaaagaaaattgcttcaaaatatattccagataca
ataataaatagaacaaaaaaaggatttaattcaccttttaatgagtggttaaataaagag
tataaagataaaatacttgatgtaatagttgaagtaaataatcaaacaaatttatttaat
catgagtatattttgcatatttacgagctttcaaaatcaaataaattcaaacagcattta
tattcactttttgttttttctttatggtataaaaaagaatttctttcttaa

DBGET integrated database retrieval system