KEGG   Arcobacter sp. L: ABLL_0242Help
Entry
ABLL_0242         CDS       T01834                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
arc  Arcobacter sp. L
Pathway
arc00010  Glycolysis / Gluconeogenesis
arc00020  Citrate cycle (TCA cycle)
arc00620  Pyruvate metabolism
arc00633  Nitrotoluene degradation
arc00640  Propanoate metabolism
arc00650  Butanoate metabolism
arc00680  Methane metabolism
arc01100  Metabolic pathways
arc01120  Microbial metabolism in diverse environments
arc01130  Biosynthesis of antibiotics
arc01200  Carbon metabolism
Module
arc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABLL_0242
   00020 Citrate cycle (TCA cycle)
    ABLL_0242
   00620 Pyruvate metabolism
    ABLL_0242
   00640 Propanoate metabolism
    ABLL_0242
   00650 Butanoate metabolism
    ABLL_0242
  Energy metabolism
   00680 Methane metabolism
    ABLL_0242
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ABLL_0242
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ABLL_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_2 Fer4_10 Fer4_6 Fer4_9 Fer4_7 Fer4_13 Fer4_4 Fer4_16 Fer4_17 Fer4_15 Fer4_8 Fer4_3 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: BAK72117
UniProt: G2HS01
Position
complement(225794..226204)
Genome map
AA seq 136 aa AA seqDB search
MSKPIREMGWDELVPGAALYTFDGSVDYNIAEIQPEDRLYSETSSKSMSVGDWRVIKPVW
NSETCIDCQNCWIFCPDSSIIARNKEMKGVDYEHCKGCGLCVSVCPTNPKSLLMFNEYVT
AEEALSQWPAKQKKGE
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaattagagaaatgggatgggatgagttagtaccaggtgctgctctttat
acattcgatggaagtgtagattataatattgctgaaattcaaccagaagatagactttat
tctgaaacaagttcaaaaagtatgtctgttggagactggagagttattaaacctgtttgg
aattctgaaacatgtattgactgtcagaactgttggattttttgcccagattcatcaatt
attgcaagaaataaagagatgaaaggtgtggattatgaacactgtaaaggttgtggatta
tgtgtaagtgtttgtcctacaaatccaaaatcactattaatgtttaatgaatatgttaca
gctgaagaagctttatctcaatggccagcgaaacaaaaaaagggtgaataa

DBGET integrated database retrieval system