KEGG   Arcobacter sp. L: ABLL_0242Help
Entry
ABLL_0242         CDS       T01834                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase delta subunit
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
arc  Arcobacter sp. L
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABLL_0242
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABLL_0242
   00020 Citrate cycle (TCA cycle)
    ABLL_0242
   00620 Pyruvate metabolism
    ABLL_0242
   00640 Propanoate metabolism
    ABLL_0242
   00650 Butanoate metabolism
    ABLL_0242
  Energy metabolism
   00680 Methane metabolism
    ABLL_0242
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ABLL_0242
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ABLL_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(225794..226204)
Genome map
AA seq 136 aa AA seqDB search
MSKPIREMGWDELVPGAALYTFDGSVDYNIAEIQPEDRLYSETSSKSMSVGDWRVIKPVW
NSETCIDCQNCWIFCPDSSIIARNKEMKGVDYEHCKGCGLCVSVCPTNPKSLLMFNEYVT
AEEALSQWPAKQKKGE
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaattagagaaatgggatgggatgagttagtaccaggtgctgctctttat
acattcgatggaagtgtagattataatattgctgaaattcaaccagaagatagactttat
tctgaaacaagttcaaaaagtatgtctgttggagactggagagttattaaacctgtttgg
aattctgaaacatgtattgactgtcagaactgttggattttttgcccagattcatcaatt
attgcaagaaataaagagatgaaaggtgtggattatgaacactgtaaaggttgtggatta
tgtgtaagtgtttgtcctacaaatccaaaatcactattaatgtttaatgaatatgttaca
gctgaagaagctttatctcaatggccagcgaaacaaaaaaagggtgaataa

DBGET integrated database retrieval system