KEGG   Arcobacter sp. L: ABLL_0243Help
Entry
ABLL_0243         CDS       T01834                                 

Definition
pyruvate flavodoxin oxidoreductase gamma subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
arc  Arcobacter sp. L
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABLL_0243
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABLL_0243
   00020 Citrate cycle (TCA cycle)
    ABLL_0243
   00620 Pyruvate metabolism
    ABLL_0243
   00640 Propanoate metabolism
    ABLL_0243
   00650 Butanoate metabolism
    ABLL_0243
  Energy metabolism
   00680 Methane metabolism
    ABLL_0243
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ABLL_0243
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ABLL_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(226216..226779)
Genome map
AA seq 187 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLGSIVAESGKQVQAFAFYGSAKRGASMTAYNRIDDNTILN
HEKYMSPDFVFILDPGLAITDDFTANGKDTTKYIITTHLSKDELISLVPELQEIKDRVFI
LDCFQIARDTIGKAIPNTPMLGAFMKVSGMYDLEYFKDKMKSVLKKLPPNLVEANMVAIQ
RAYDEVH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattagatggcatagccgtgcaggtcaaggtgctgttactggggcaaaaggt
cttggttcaattgttgctgaatctggaaaacaagttcaagcatttgcattttatggatct
gcaaaaagaggtgcgtctatgactgcttacaatagaattgatgataatacaattttaaac
cacgaaaaatatatgagtcctgattttgtatttatattagatccaggtcttgctataact
gacgattttactgctaatggcaaagatacaactaaatatattattacaactcaccttagt
aaagatgagttaatttcattagttcctgaacttcaagaaattaaagatagagtatttata
cttgactgtttccaaattgcaagagatacaattggaaaagctattcctaatactccaatg
cttggtgcatttatgaaagttagtggaatgtatgacttagaatactttaaagataaaatg
aaaagtgtactaaaaaaattgccaccaaatctagttgaagcaaatatggtagcaatccaa
agagcttatgacgaagttcattag

DBGET integrated database retrieval system