KEGG   Arcobacter sp. L: ABLL_0243Help
Entry
ABLL_0243         CDS       T01834                                 

Definition
(GenBank) pyruvate flavodoxin oxidoreductase gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
arc  Arcobacter sp. L
Pathway
arc00010  Glycolysis / Gluconeogenesis
arc00020  Citrate cycle (TCA cycle)
arc00620  Pyruvate metabolism
arc00633  Nitrotoluene degradation
arc00640  Propanoate metabolism
arc00650  Butanoate metabolism
arc00680  Methane metabolism
arc01100  Metabolic pathways
arc01120  Microbial metabolism in diverse environments
arc01130  Biosynthesis of antibiotics
arc01200  Carbon metabolism
Module
arc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABLL_0243
   00020 Citrate cycle (TCA cycle)
    ABLL_0243
   00620 Pyruvate metabolism
    ABLL_0243
   00640 Propanoate metabolism
    ABLL_0243
   00650 Butanoate metabolism
    ABLL_0243
  Energy metabolism
   00680 Methane metabolism
    ABLL_0243
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ABLL_0243
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     ABLL_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Peroxin-22
Motif
Other DBs
NCBI-ProteinID: BAK72118
UniProt: G2HS02
Position
complement(226216..226779)
Genome map
AA seq 187 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLGSIVAESGKQVQAFAFYGSAKRGASMTAYNRIDDNTILN
HEKYMSPDFVFILDPGLAITDDFTANGKDTTKYIITTHLSKDELISLVPELQEIKDRVFI
LDCFQIARDTIGKAIPNTPMLGAFMKVSGMYDLEYFKDKMKSVLKKLPPNLVEANMVAIQ
RAYDEVH
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaattagatggcatagccgtgcaggtcaaggtgctgttactggggcaaaaggt
cttggttcaattgttgctgaatctggaaaacaagttcaagcatttgcattttatggatct
gcaaaaagaggtgcgtctatgactgcttacaatagaattgatgataatacaattttaaac
cacgaaaaatatatgagtcctgattttgtatttatattagatccaggtcttgctataact
gacgattttactgctaatggcaaagatacaactaaatatattattacaactcaccttagt
aaagatgagttaatttcattagttcctgaacttcaagaaattaaagatagagtatttata
cttgactgtttccaaattgcaagagatacaattggaaaagctattcctaatactccaatg
cttggtgcatttatgaaagttagtggaatgtatgacttagaatactttaaagataaaatg
aaaagtgtactaaaaaaattgccaccaaatctagttgaagcaaatatggtagcaatccaa
agagcttatgacgaagttcattag

DBGET integrated database retrieval system