KEGG   Arcobacter sp. L: ABLL_0346Help
Entry
ABLL_0346         CDS       T01834                                 

Definition
flagellar hook-associated protein 2
Orthology
K02407  
flagellar hook-associated protein 2
Organism
arc  Arcobacter sp. L
Pathway
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:arc00001]
 Cellular Processes
  Cell motility
   02040 Flagellar assembly
    ABLL_0346
Bacterial motility proteins [BR:arc02035]
 Flagellar system
  Flagellar assembly proteins
   Rod,hook and filament
    ABLL_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
332244..333590
Genome map
AA seq 448 aa AA seqDB search
MASGILGLGSGQAASLNSDLIEKLKTAERKATVEPYDTKIENITKEKEVFSSIETKVSEL
LNAIKPFDLFVSGGVSAFEQKSATTSGDSVTFDAADVKSLKKGFTSVEVTQLAQKDVYQS
NSFNSTIKDGTVDQGDLIINGETFNTNGKTYQQLADEISTKSGMNASIEQVGTDSFRLVI
KSEDTGLDNALSISGQASQALGYTTDQITVNTSNHILEAKNMIAKVDGVTYDVSSNTITV
DGLKITANKEGTSSINIVEDNTQVETQMQNFITKYNELVALVDGEVYNADSKLGDKSSIR
DIIDQVKSKLFGSYGSSSDKSVFNYGIELDRYGSLSLDSTKFNDAVQNDMTGLKDLFLGT
AEKKGLGTVLKETIDQMTFTGGTLDLYAKSMTTRETTLNTEKNKAEEALNAKYELLSLQF
SSYGTIINQMESSFSGLKMLIQQSTVSN
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggctagtggaatattaggattaggttcaggacaagcagcttctttaaatagtgattta
attgaaaaattaaaaacagcagaaagaaaagctactgttgaaccatatgatacaaaaata
gagaatattacaaaagaaaaagaagttttttcaagtattgaaacaaaagtttctgagtta
ctaaatgcaataaaaccttttgatttatttgtatctggtggagtaagtgcatttgaacaa
aaatcggcaacaacttctggtgattcagttacttttgatgctgcagatgttaaatcctta
aaaaaaggatttacaagtgttgaagtaacacaattagctcaaaaagatgtttaccaatca
aatagttttaattcaacaataaaagatggaactgttgatcaaggcgacttaataattaat
ggcgaaacatttaatacaaatggaaaaacttatcaacagttagctgatgaaataagtaca
aaatctggaatgaatgcttcaatagagcaagtaggtacagattcttttagattagttatt
aaaagtgaagatactggacttgacaatgctttatctattagtggtcaagcaagtcaagct
ttaggatatacaacagatcaaattacagttaatacctcaaatcacatattagaagctaaa
aatatgattgcaaaagttgatggagttacatatgatgtttcttcaaatacaataactgtt
gatggattaaaaataacagctaataaagaaggtacatcttcaataaatatagtagaagat
aatactcaagttgagacacaaatgcaaaatttcattacaaaatacaatgaattagtagct
ttagttgatggagaagtatataatgcagattctaaactaggagataaatcttcaataaga
gatataatagatcaagtaaaaagtaaattatttggttcatatggttcttctagcgataaa
tcagtatttaactatggaatagaacttgatagatatggttctttatctttagattcaaca
aaatttaatgatgcagttcaaaatgatatgacaggattaaaagatttatttttaggaaca
gcagaaaaaaaaggtttaggaacagtattaaaagaaactattgatcaaatgacttttact
ggtggaactttagatttgtatgcaaaatcaatgacaacaagggaaacaactttaaatact
gaaaaaaataaagcagaagaagctttaaatgcaaaatatgagcttttatctttacaattt
agttcatatggaacaataattaatcagatggagtcttcattttctggattaaagatgttg
atacaacagtcaacagtaagtaattag

DBGET integrated database retrieval system