KEGG   Arcobacter sp. L: ABLL_0397Help
Entry
ABLL_0397         CDS       T01834                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
arc  Arcobacter sp. L
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ABLL_0397
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ABLL_0397
Enzymes [BR:arc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     ABLL_0397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
379832..380710
Genome map
AA seq 292 aa AA seqDB search
MQHLIRTSDFSKEEIMGIFDDAREFLKFEPNEILKGKIIVTLFFENSTRTRSSFEIAAKR
LGAEVVSLDVGTSSTNKGETIFDTVANINAMKPDAIIIRHSECGLPESLTGFVDCPIINA
GDGKHSHPTQALLDLFTIYEHFEGKTEGKKIAIVGDVKSSRVAGSNRRLLPRFGIDVNLV
APDCFKYEGDEFKQYNNINEIIDELNIIMSLRTQLERHNQIYFESLQEYAKDYCITNEVV
GDRDIILLHPGPVNRNVDISDEMLKDPRSKVLKQVTHGVAIRAAVLKKLILK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatttgattagaacttcggatttttcaaaagaagagataatgggcatctttgat
gatgcaagagagtttttaaaatttgaaccaaatgaaattttaaaaggtaaaattatagtt
actttgttttttgaaaattctacaaggactagaagttcatttgaaattgcagctaagaga
ttaggagctgaggttgtatcacttgatgtaggaacatcttctacaaataaaggtgaaaca
atttttgatacagttgcaaatataaatgctatgaaaccagatgcaattattattagacat
agtgaatgtggattaccagaaagtttaacaggttttgtagattgtcctataataaatgca
ggtgatggaaaacattcacatccaactcaagctcttttagatttatttacaatttatgag
cattttgaaggaaaaactgaaggtaaaaaaatagcaatagttggagatgtaaaaagttca
agagttgcaggttcaaatagaaggttactaccaagatttggaattgatgtaaatttagtt
gctcctgattgttttaaatatgaaggagatgaatttaaacaatataataatatcaatgaa
ataatagatgaacttaatattattatgagtttaagaacacaacttgaaagacataatcaa
atatattttgaatctttacaagaatatgcaaaagattattgtattacaaatgaagttgta
ggagatagagatattatccttttacacccaggaccagttaatagaaatgttgatattagt
gatgaaatgttaaaagatccaagatcaaaagttttaaaacaagtaactcatggtgttgct
ataagagctgctgttcttaaaaaacttattttaaagtaa

DBGET integrated database retrieval system