KEGG   Arcobacter sp. L: ABLL_0413Help
Entry
ABLL_0413         CDS       T01834                                 

Definition
glutamate dehydrogenase
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
arc  Arcobacter sp. L
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:arc00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:arc00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:arc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
390950..392302
Genome map
AA seq 450 aa AA seqDB search
MPYLEEVFNYLKRTSPAQTEFYQAAEEVLYSLQPLLDKYPQYRKHKIIERIVEPERQIMF
RVNWLDDNGEIQVNKGFRIEFNSALGPYKGGLRFHPSVNAGVIKFLGFEQIFKNALTGLQ
IGGGKGGSDFNPKGKSDNEIMRFCQAFMSELYRHIGANTDVPAGDIGVGAREIGYMFGMY
KKLANRYEGVFTGKSLKWGGSLARTEATGYGCVYFAKNMLAARGESLEGQRCVVSGSGNV
AIYTIEKLYHLGALPITCSDSKGMILDEEGIDLLLLKDLKENKRVRLTEYVKYRPNAKYI
PIEEYPEGKNMVWSIPCFAAFPSATQNELNLEDAKTLLSNGCKCVSEGANMPSTPQAVDL
FVDAKIAYGPGKAANAGGVATSQLEMAQNASMLSWTFEEVDAKLEQIMKNIFESASSTAA
EFGQPTNLVLGANIAGFRKVADAMIEQGLV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgccatatttagaagaagtttttaactatcttaaaagaacaagtccagcccaaacagaa
ttttatcaagcagcagaagaagtgttatattcattgcaaccattgcttgacaaatatcct
caatatagaaagcacaaaattattgaaagaatagttgagccggaaagacaaataatgttt
agagtaaattggcttgatgataatggagaaattcaagtaaataaaggttttcgaatagaa
tttaattcagcacttggaccatataaaggtggtcttagatttcatccaagtgtaaatgct
ggagtgattaaatttttaggatttgaacaaatatttaaaaatgcactaacaggtcttcaa
attggtggaggaaaaggtggaagtgattttaatccaaaaggaaaatcagacaatgaaatc
atgagattttgccaagcatttatgagtgaattatatagacatattggtgcaaatactgat
gttccagctggtgatattggagttggtgctagagaaataggttatatgtttgggatgtat
aaaaaacttgcaaatagatatgaaggcgtatttactggaaaatcattaaaatggggtggt
tctttagctagaacagaagctacaggttatggatgtgtatattttgcaaaaaatatgctt
gcagcacgaggagagagtctagaaggacaaagatgtgtagtttctggttcaggaaatgtt
gctatttatactatagaaaaattatatcatcttggtgcattacctattacttgtagtgat
tcaaaaggtatgattttagatgaagaaggaatagatttacttttattaaaagatttaaaa
gagaataaaagagtaagattaactgaatatgtaaaatatagaccaaatgctaaatatatc
cctattgaagagtatccagaaggaaaaaatatggtttggtcaataccatgttttgcagca
tttccaagtgcgacacaaaatgaattaaatttagaagatgcaaaaacattattatcaaat
ggctgtaaatgtgtaagtgaaggtgctaatatgccatcaactcctcaagctgttgattta
tttgtagacgcaaagattgcttatggaccaggaaaagcagcaaatgcaggtggagttgca
acaagtcaattagaaatggcacaaaatgcttcaatgctttcttggacttttgaagaagtt
gatgcaaaattagaacaaattatgaaaaatatttttgaatcagcaagttcaactgcagct
gaatttggacaaccaacaaacttagttttaggagcaaacatcgcaggatttagaaaagta
gctgatgctatgatagagcaaggtttagtataa

DBGET integrated database retrieval system