KEGG   Arcobacter sp. L: ABLL_0482Help
Entry
ABLL_0482         CDS       T01834                                 

Definition
phosphodiesterase/alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
arc  Arcobacter sp. L
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:arc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:arc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:arc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
469126..470901
Genome map
AA seq 591 aa AA seqDB search
MRFSRRDFIKMSALSFCSLVVSTGISGCGNDSNPTKIEFLHGVASGDPTQNSVIIWTRLT
PDSQLDSLNFSYEVSEYKDFSTLVHSGDAKTKKEQDYTVKIDLQNLEAGTVYYYRFKANG
KISVVGRTKTISSNPNSVKMAVFSCSNYPNGYFNSYMEASKIEDLDIAVHLGDYIYEYGM
YESDGITPAYATKNAIAIGRALPSDNNTELLTLDDYRKRYALYRTDEGLFALHKNVPFIT
IWDDHEIANDTYKDGAENHDSLTEGDFNTRKLAALQAYFEWLPIRPYAEGNNEVIYRSFE
FGDLLTLYMLDTRVIGRDKQLSYSDYFDSYGNFDSATFSADLTNTSRTMMGAEQLSWLQG
KLASSTSNWQVLGQQVLMGKMFLPAELLTSISQLEGELTTEQKNSLLIQLNQQVTELVTI
KTRILSGDTTLTNEEKARVNTTLPYNLDAWDGYFYEREVLFGTVLSLNKNLVVLAGDTHN
SWANELKDSNGNAVGVEFAVTSVTSPGMEDYAGLSTLETAVAFENAITLLIDDLKYTNLN
QRGFMTLTFTSSEVNTTWYYIDNYDSTTYSLDTTRQKELKNILGNKTLEIL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagattttcaagaagagattttataaaaatgtctgcattaagtttttgttcattagtt
gtttcaactggaataagtggttgtggaaatgattctaatcctacaaaaattgagttttta
catggtgtcgcaagtggagatccaacacaaaatagtgtaataatttggactagattaact
cctgattctcaattagatagtttaaacttttcatatgaagtttcagaatataaagatttt
tcaactttagttcattcaggtgatgcaaaaactaaaaaagaacaagattatacagtaaaa
atagatttacaaaatttggaagctggaacagtttattattatagatttaaagctaatgga
aaaatatcagttgtcggaagaacaaaaacaatttcatcaaatccaaatagcgtaaaaatg
gctgtattctcatgttcaaattatccaaatggttattttaattcttatatggaagcttca
aaaattgaagatttagatattgctgttcatttaggagattatatatatgaatatggaatg
tacgaaagtgatggaattacacctgcttatgcaacaaaaaatgcaattgcaataggaaga
gctttaccatcagataataatacagagcttttaaccttagatgattatagaaagagatat
gccttatatagaacagatgaaggcttatttgctttacataaaaatgtgccatttattaca
atctgggatgaccatgaaattgcaaacgatacatataaagatggtgctgaaaatcatgat
tctcttacagaaggtgattttaatacaagaaaattagctgctttacaagcatattttgaa
tggttgccaattcgtccttatgcagaagggaataatgaagttatttatagaagttttgaa
tttggtgatttattaactctttatatgttagatacaagagttattggtagagataaacag
ttgagttattcagattattttgattcatatggaaactttgattctgcaacttttagtgca
gatttaacaaatacaagtagaacaatgatgggagctgaacaattatcttggttacaaggg
aaattagcttcatcaacttcaaattggcaagttttaggacagcaagtattaatgggaaaa
atgtttttacctgctgaattattaacttcaatttctcaattagaaggagagttaacaact
gaacaaaaaaatagtttattaattcaattaaatcaacaagttacggaattagttacaata
aaaacaagaattttatcaggtgatacaacacttacaaatgaagaaaaagcaagagtaaat
acaactttaccatataacttagatgcttgggatggatatttttatgaaagagaagttctt
tttggaacagttctatctttaaataaaaatcttgttgttttagcaggagatacacataat
tcttgggcaaatgaattaaaagattcaaatggaaatgctgttggtgttgagtttgcagta
acttctgttacttctcctggaatggaagattatgcaggattatcaacattagaaacagca
gtggcatttgaaaatgctattacacttttaattgatgatttaaaatatacaaatttaaac
caaagaggttttatgactttaacttttacaagcagcgaagtaaatactacttggtattat
atagataattatgattcaacaacatattctttagatacaacaagacaaaaagagttgaaa
aatatattgggaaataagactttagaaattttatag

DBGET integrated database retrieval system