KEGG   Arcobacter sp. L: ABLL_0517Help
Entry
ABLL_0517         CDS       T01834                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
arc  Arcobacter sp. L
Pathway
arc00340  Histidine metabolism
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01230  Biosynthesis of amino acids
Module
arc_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ABLL_0517
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ABLL_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh CENP-X
Motif
Other DBs
NCBI-ProteinID: BAK72392
UniProt: G2HTD9
Position
504548..505840
Genome map
AA seq 430 aa AA seqDB search
MKIINTKDTNFQSEFDSILARAKSDIKGVSSIVMNIIDEIVAEGNVALKRHIEKFDKWEV
KSDNDLLISQDDMKKAYENIDEKLRLALHTAYDRIKTYHEKQLPKSWLDFESNGTILGQK
VTPVDKAGLYIPGGKAAYPSSLLMNAVPAIVAGVKEIVVCTPTPNNEVNELLLAACHLCK
VSKVYKVGGASAIAAMAYGTQTIPKVDVITGPGNIFVATAKKLVFGEVNIDMIAGPSEIG
ILADETAKPHYLAIDLLSQAEHDEMASSIMITTCDEVASLTSKEVEEYLKTLSREAIARK
SIDERGAIIVASNMEEAISLMNEIAPEHLEVMTQNPFELLPYIKHAGAIFLGENTPEPIG
DYIAGPNHTLPTGSTAKFYSPLNVENFMKKSSIINFSKNAINELGEACALLADTEGLTAH
AKSVRVRLEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataataaatacaaaagatacgaactttcaaagtgaatttgattctattttagca
agagctaaaagtgatataaaaggcgtttcatcaattgttatgaatattattgacgaaata
gtagcagaaggaaatgttgctttaaaaagacatattgaaaagtttgataaatgggaagtt
aaatcagataatgatttattgatttctcaagatgatatgaaaaaagcatatgaaaatatt
gatgagaaactaagacttgctcttcatacagcatatgatagaattaaaacatatcatgaa
aaacaacttccaaaatcttggcttgattttgagtcaaatgggacaattttaggacaaaaa
gttactcctgtggataaagctgggctttatattcctggtggaaaagctgcatatcctagt
tcacttttgatgaatgcagttccagcaattgttgctggagttaaagaaatagttgtatgt
acaccaactccaaataatgaagtaaatgaacttttacttgctgcttgccacttatgtaaa
gtttcaaaagtttataaggttggaggagcaagtgcaattgctgctatggcttatggaaca
caaactatccctaaagttgatgtaataactggtcctggaaatatttttgttgctactgct
aaaaaacttgtatttggtgaagttaatattgatatgattgcaggtccttctgaaattgga
attttagctgatgaaacagcaaaacctcactatttagcaattgatttattatctcaagct
gaacatgatgaaatggcaagttcaattatgattacaacttgtgatgaagttgctagttta
acaagtaaagaagttgaagagtatttaaaaactttaagtagagaagcaattgctagaaaa
tcaatagatgaaagaggagcaataattgttgcttcaaatatggaagaagcaatctcttta
atgaatgaaatagcacctgaacacttagaagttatgacacaaaatccttttgaattgtta
ccttatatcaaacatgcaggtgcaattttcttaggtgaaaatactcctgaaccaattgga
gattatatagcaggtcctaatcatactcttccaacaggaagtacagctaagttttatagt
ccattaaatgtagaaaattttatgaaaaaaagttcaattataaatttctcaaaaaatgct
ataaatgaattaggtgaagcttgtgccttattagcggatacagaaggtcttacagctcat
gctaaatctgtaagagttagattagaaaaatag

DBGET integrated database retrieval system