KEGG   Arcobacter sp. L: ABLL_0652Help
Entry
ABLL_0652         CDS       T01834                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
arc  Arcobacter sp. L
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:arc00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:arc00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658329..659615
Genome map
AA seq 428 aa AA seqDB search
MQLIINNRIYTDNSNEVDENSVFVVSKQNEKFKQSAIDNGCGEIITASELKNHLDMSSIK
VIGITGTNGKTTTAAAIYSILLDLGYKVALQGTRGFFINDERVEEYSLTTPVQLGNFAHI
QKAIQNGCNFFVMEVSSHAIEQKRIEGLEFALKIHTNITRDHLDYHKTIEEYIRVKNSFF
EDESPKLINKDDDKVRYNIKNGFAYSLENPSTYKVDAYSFKNGMHVMFNHFGKHYSFSSY
MMGIFNVYNLMAAVAAVHITTKKPLEEICEALEGFGGVSGRMETISVNPLVIVDFAHTPD
GMDEVLKSFNDKDIICVFGAGGDRDKLKRPLMGTVAAKYSKDIIVTSDNPRFEDPDMIIE
DILAGIKNHPSVQVEINRKEAIKKAIEMADENSVVLLLGKGDESTQIIYDKKFPFSDKEE
VLKILNKE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgcaactaatcataaataatagaatttatactgataattcaaatgaagtagatgaaaat
tctgtttttgttgtttcaaaacagaatgaaaaatttaaacaaagtgcaattgataatgga
tgcggtgagataataactgcaagtgaattaaaaaatcacttagatatgtcaagcatcaaa
gttattggaataactggaacaaatggaaaaacaacaacagctgcagctatttattcaatt
cttttagatttaggttataaagttgcactacaaggtacacgaggatttttcataaatgac
gaaagagttgaagaatattctttaacaactcctgttcaacttggaaattttgcacatatt
caaaaagcaatacaaaatggttgtaatttttttgtgatggaagttagctctcatgcaatt
gaacaaaaaagaattgaaggtttagagtttgctttaaaaatccatacaaatataacaaga
gatcatttggattatcataaaacaattgaagagtatataagagttaaaaattcatttttt
gaagatgaatcaccaaaactaatcaataaagatgatgataaagtaagatacaacataaaa
aatggatttgcatactctttagaaaatccatcaacatataaagttgacgcatactctttt
aaaaatggtatgcatgtaatgtttaatcattttggaaaacattactctttttcatcttat
atgatgggaatttttaatgtttacaatctaatggctgcagttgcagctgttcacataact
acaaaaaaaccattagaagagatttgtgaagctcttgaaggttttggtggagttagtgga
agaatggaaacaattagtgttaatcctttagttatagttgattttgctcatactcctgat
ggaatggatgaagttctaaaaagttttaatgataaagatattatttgtgtatttggagca
ggtggagatagagataaacttaaacgtccattgatgggaacagttgcagcaaaatattca
aaagatattattgtaacaagtgataatccaagatttgaagatcctgatatgattattgaa
gatatattagctggaataaaaaatcatccaagtgttcaagttgaaataaatagaaaagaa
gctattaaaaaagcaattgaaatggctgatgagaatagtgttgttttacttcttggaaaa
ggtgatgaatcaacacaaattatttatgataaaaaatttccattttctgataaagaggaa
gttttaaagattttaaataaagagtaa

DBGET integrated database retrieval system