KEGG   Arcobacter sp. L: ABLL_0652Help
Entry
ABLL_0652         CDS       T01834                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
arc  Arcobacter sp. L
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ABLL_0652
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABLL_0652
Enzymes [BR:arc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     ABLL_0652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
658329..659615
Genome map
AA seq 428 aa AA seqDB search
MQLIINNRIYTDNSNEVDENSVFVVSKQNEKFKQSAIDNGCGEIITASELKNHLDMSSIK
VIGITGTNGKTTTAAAIYSILLDLGYKVALQGTRGFFINDERVEEYSLTTPVQLGNFAHI
QKAIQNGCNFFVMEVSSHAIEQKRIEGLEFALKIHTNITRDHLDYHKTIEEYIRVKNSFF
EDESPKLINKDDDKVRYNIKNGFAYSLENPSTYKVDAYSFKNGMHVMFNHFGKHYSFSSY
MMGIFNVYNLMAAVAAVHITTKKPLEEICEALEGFGGVSGRMETISVNPLVIVDFAHTPD
GMDEVLKSFNDKDIICVFGAGGDRDKLKRPLMGTVAAKYSKDIIVTSDNPRFEDPDMIIE
DILAGIKNHPSVQVEINRKEAIKKAIEMADENSVVLLLGKGDESTQIIYDKKFPFSDKEE
VLKILNKE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttgcaactaatcataaataatagaatttatactgataattcaaatgaagtagatgaaaat
tctgtttttgttgtttcaaaacagaatgaaaaatttaaacaaagtgcaattgataatgga
tgcggtgagataataactgcaagtgaattaaaaaatcacttagatatgtcaagcatcaaa
gttattggaataactggaacaaatggaaaaacaacaacagctgcagctatttattcaatt
cttttagatttaggttataaagttgcactacaaggtacacgaggatttttcataaatgac
gaaagagttgaagaatattctttaacaactcctgttcaacttggaaattttgcacatatt
caaaaagcaatacaaaatggttgtaatttttttgtgatggaagttagctctcatgcaatt
gaacaaaaaagaattgaaggtttagagtttgctttaaaaatccatacaaatataacaaga
gatcatttggattatcataaaacaattgaagagtatataagagttaaaaattcatttttt
gaagatgaatcaccaaaactaatcaataaagatgatgataaagtaagatacaacataaaa
aatggatttgcatactctttagaaaatccatcaacatataaagttgacgcatactctttt
aaaaatggtatgcatgtaatgtttaatcattttggaaaacattactctttttcatcttat
atgatgggaatttttaatgtttacaatctaatggctgcagttgcagctgttcacataact
acaaaaaaaccattagaagagatttgtgaagctcttgaaggttttggtggagttagtgga
agaatggaaacaattagtgttaatcctttagttatagttgattttgctcatactcctgat
ggaatggatgaagttctaaaaagttttaatgataaagatattatttgtgtatttggagca
ggtggagatagagataaacttaaacgtccattgatgggaacagttgcagcaaaatattca
aaagatattattgtaacaagtgataatccaagatttgaagatcctgatatgattattgaa
gatatattagctggaataaaaaatcatccaagtgttcaagttgaaataaatagaaaagaa
gctattaaaaaagcaattgaaatggctgatgagaatagtgttgttttacttcttggaaaa
ggtgatgaatcaacacaaattatttatgataaaaaatttccattttctgataaagaggaa
gttttaaagattttaaataaagagtaa

DBGET integrated database retrieval system