KEGG   Arcobacter sp. L: ABLL_0663Help
Entry
ABLL_0663         CDS       T01834                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
arc  Arcobacter sp. L
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ABLL_0663
Enzymes [BR:arc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     ABLL_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
668298..668921
Genome map
AA seq 207 aa AA seqDB search
MIKEKKGAILIISGPSGCGKSTLLKEVYKNIDNYYFSISTTTRAPRVGEVNGIDYFFVSK
EEFEEDIKNNDFLEYAKVHDNYYGTSLKPINKALEEGKLIIFDIDVQGHEIVRNKINALV
TSVFITTPSLNVLEERLNSRNTDSLEIIEKRIKNAKAEVEFFQDYDYLIINDDLQTAAKE
LVCIANITRIKTKLFKKENIISNWLSN
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagagaaaaaaggtgcaattttaatcatctcaggtcctagcggttgtggaaaa
tcaactctattaaaagaagtatataaaaatattgataattactatttttctatttcaact
acaacaagagctccaagagttggagaagtaaatggtattgattacttttttgtttctaaa
gaagagtttgaagaagatataaaaaacaatgattttttagaatatgcaaaagtacatgat
aactattatggaacatcattaaaacctattaataaagctttagaagagggtaaattgata
atttttgatattgatgttcaaggtcatgaaattgttagaaataagataaatgctttagtt
acatcagtatttattacaacgccatctttaaatgttttagaagagagattaaatagtaga
aatacagatagtttagaaattattgaaaaaagaattaaaaatgctaaagcagaagttgaa
ttttttcaagattacgattatttaataattaatgatgatttacaaacagctgcaaaagaa
ttagtttgtattgcaaatataaccagaataaaaactaaacttttcaagaaagaaaatata
atatcaaattggctaagtaattaa

DBGET integrated database retrieval system