KEGG   Arcobacter sp. L: ABLL_0824Help
Entry
ABLL_0824         CDS       T01834                                 

Definition
putative hexose epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
arc  Arcobacter sp. L
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ABLL_0824
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABLL_0824
Enzymes [BR:arc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ABLL_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
836394..836966
Genome map
AA seq 190 aa AA seqDB search
MNYKRLEIRDLVLCEPTFHKDNRGFVYESFKKESFNNFLGFEVDFCQDNISYSTYGVIRG
LHTNTLDFSQSKLVSVLQGKILDVAVDFRVGSPSFGKVVSVELNSEENKQLFIPRGFLHG
FSVLSEDALVMIKIDRYFASGESIGIRYDDKDLSIDWKIDEKFVILSEADKKLSNFKDIK
SPFVYGENYY
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaattataaaagattagaaattcgagatttagtactttgtgaaccaacttttcataaa
gataatcgtggatttgtttatgaatcatttaaaaaagagtcttttaataattttttagga
tttgaagtagatttttgtcaagataatatttcttatagcacgtatggagttataagagga
cttcatacaaatactttagatttttcccaatcaaaacttgtaagtgttttacaaggcaaa
atccttgatgtagcagttgattttagagtaggaagtccaagttttggaaaagtagtaagt
gtagagttaaatagtgaagaaaataaacaacttttcataccaagaggatttttacatggt
ttttcagttttaagtgaagatgcacttgttatgataaaaattgatagatattttgcaagt
ggtgaaagtataggtatcagatatgatgacaaagatttatcaattgattggaaaatagat
gaaaaatttgttattttatctgaagctgataaaaaattatcaaattttaaagacataaaa
tcaccatttgtttatggtgaaaattattattag

DBGET integrated database retrieval system