KEGG   Arcobacter sp. L: ABLL_0964Help
Entry
ABLL_0964         CDS       T01834                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
arc  Arcobacter sp. L
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:arc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABLL_0964
Enzymes [BR:arc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ABLL_0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
996299..996862
Genome map
AA seq 187 aa AA seqDB search
MIVGLVGKITKKEPTLLNINVNGIIYEVFVSINCSSKIISDDVKLEITHIIREDSQSLYG
FLDSNEKKLFDTVIKINGVGPKVALAICSTFTPTSFAQIVNENDVSMLKRVPGIGPKGAS
RILVELSGFIVDSNDSDDSSSLSSSFEAALALESLGFKKDIVTKILKTCVSSNTSDLVKE
ALKKLQK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgattgtagggcttgtaggaaaaataacaaagaaagaaccgacgttattaaacattaat
gtaaatggaattatttatgaagtatttgtatcaattaattgtagttcaaaaattatttca
gatgatgtgaaattagaaataactcacataataagagaagattctcagtctttatatggt
tttttagattcaaatgaaaaaaaactttttgatacagttattaaaataaatggagttggt
ccaaaagttgcacttgcaatttgctccactttcacaccaacatcatttgctcaaatcgta
aatgaaaatgatgtctcaatgttgaaaagagttcctggaattggacctaaaggtgctagt
cgaattttagtagaattatctggatttattgtagattctaatgacagtgatgacagttct
agtttatcttcatcatttgaagcggctcttgctttagaatctctaggatttaaaaaagat
attgtaactaaaattttaaaaacttgtgttagctcaaatacgagtgatttagtaaaagaa
gcattaaaaaaattacaaaaataa

DBGET integrated database retrieval system