KEGG   Arcobacter sp. L: ABLL_1047Help
Entry
ABLL_1047         CDS       T01834                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
arc  Arcobacter sp. L
Pathway
arc00620  Pyruvate metabolism
arc00630  Glyoxylate and dicarboxylate metabolism
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
arc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABLL_1047
   00630 Glyoxylate and dicarboxylate metabolism
    ABLL_1047
Enzymes [BR:arc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ABLL_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: BAK72922
UniProt: G2HUW9
Position
1072432..1074615
Genome map
AA seq 727 aa AA seqDB search
MQRIKQGNLKIERGIFDLINNEILPKTEISENEFWKSFENIIETLTPINKELLKTRDDLQ
KKIDNWYKTNKYDSTNLDKYKNFLKEIGYLVEQKEDFKIDTKNIDDEITLQAGPQLVVPV
KNARFALNAANARWGSLYDALYGTDVISKEGDLAITKEYNKKRGEAVVTYAKEFLDESIT
LQKGSYKDVIEFKIVNNELIITLENGETTTLKDKEKFLGFIGEIENPQTLIFKNNNLHIQ
IQIDKNSFIGCLDKAFIKDVILEAAVTTIMDCEDSVAAVDAIDKAEVYKNWFGLMKGDLE
DSFSKNGKIMTRTLNEDITYKTIDGNSKTLHGRSLLFVRNVGHLMTNPAILDENDEEVFE
GIMDCMITVLCSIVDIKGANSKSNSRQKSVYIVKPKMHGPKEVEFTVKTFEMVEDALKLP
RNTIKIGIMDEERRTTLNLKECIRAAKSRVVFINTGFLDRTGDEIHTSMFAGAFVQKSKM
KEQVWIKAYENSNVDIGLECGLQGFAQIGKGMWAMPDEMAKMMVEKINHPKSGANTAWVP
SPTAAVLHSIHYHKVDVFEVQNNLKGDKRASLDELLTLPLMKDISILSKEEIKKELDNNA
QTILGYVVRWIDSGIGCSKVLDINNVALMEDRATLRISSQHLANWIEHKVCTKDDVMDSL
KAMAKVVDVQNTSDLSYINMAPSFDGYAFKAACDLIFEGISQPSGYTEPLLHKYRRELKN
RRILMTN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaataaaacaaggtaatttaaaaatagaaagaggaatttttgatttaataaat
aatgaaatattaccaaaaacagaaatttcagaaaatgagttttggaaaagttttgaaaat
attatagaaactctaactcctataaataaagagttgctaaaaacaagagatgatttacaa
aaaaagattgataattggtataaaacaaataaatatgattcaactaatttagataaatat
aaaaattttttaaaagaaattggatacttagttgaacaaaaagaagattttaaaatagat
acaaaaaatatagatgatgagataactttacaagctggccctcaacttgttgttcctgtt
aaaaatgcaagatttgctctaaatgctgcaaatgcaagatggggaagtttatatgatgct
ttatatggaacagatgttatatcaaaagagggtgatttagctattacaaaagagtataac
aaaaaaagaggtgaagcagttgtaacttatgcaaaagagtttttagatgaatcaattact
ttgcaaaaaggctcttataaagatgtaattgagtttaaaatagtaaataatgaacttatt
ataactttagaaaatggtgaaacaacaacattaaaagataaggaaaaattcttaggtttt
attggagaaattgaaaatcctcaaacacttatttttaaaaataataatctacatattcaa
atacaaatagataaaaatagttttataggatgtttagataaagcctttataaaagatgtt
attttagaagcagcagttactactattatggattgtgaagattcagttgcagcagttgat
gcaattgataaagcagaagtttataaaaattggtttgggcttatgaaaggtgatttagaa
gatagtttttcaaaaaatggaaaaattatgacaagaactctaaacgaagatataacttat
aaaacaatagatggaaatagtaaaactttacatggaagaagtctgctttttgttagaaat
gtaggtcatcttatgacaaatcctgcaattttagatgaaaatgatgaagaagtttttgaa
ggaattatggattgtatgattactgttttatgctcgattgtagatataaaaggagcaaat
agtaaatcgaactcaagacaaaaaagtgtttatatagttaaaccaaaaatgcacggacca
aaagaggtagaatttacagtaaaaacttttgaaatggttgaagatgctctaaaacttcct
cgaaatacaatcaaaataggaataatggatgaagaaagacgaacaactttaaatctaaaa
gagtgcataagagctgctaaaagtagagttgtatttataaatactggatttttagataga
actggtgatgagattcatacttctatgtttgctggtgcatttgttcaaaaatcaaaaatg
aaagagcaagtttggattaaagcttatgaaaattcaaatgttgatataggtttagagtgt
ggtttacaaggatttgctcaaataggaaaaggtatgtgggcgatgcctgatgagatggca
aaaatgatggttgaaaaaatcaatcatccaaaatcaggagcaaacacagcttgggttcct
tctccaacagcagcagttttacactcaattcattatcataaagtagatgtatttgaagtt
caaaataatttaaaaggggataaaagagcatctttagatgaacttttaactcttccactt
atgaaagatatatcgattttaagtaaagaagagataaaaaaagagcttgataataatgct
caaacaattttaggttatgttgttagatggattgattctggaattggatgttcaaaagtt
ttagatataaataatgtagcacttatggaagatagagcaactttaagaatctcttctcaa
catttagcaaattggattgaacataaagtttgtacaaaagatgatgtaatggactcttta
aaagctatggcaaaagttgttgatgttcaaaatacttctgatttgtcatatataaatatg
gctccatcttttgatggatatgcttttaaagcagcttgcgatttgatttttgaagggatt
tctcaaccatcaggttatactgaaccattattgcataaatatagaagagaattgaaaaat
agaagaattttaatgactaattaa

DBGET integrated database retrieval system