KEGG   Arcobacter sp. L: ABLL_1047Help
Entry
ABLL_1047         CDS       T01834                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
arc  Arcobacter sp. L
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABLL_1047
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABLL_1047
   00630 Glyoxylate and dicarboxylate metabolism
    ABLL_1047
Enzymes [BR:arc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ABLL_1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1072432..1074615
Genome map
AA seq 727 aa AA seqDB search
MQRIKQGNLKIERGIFDLINNEILPKTEISENEFWKSFENIIETLTPINKELLKTRDDLQ
KKIDNWYKTNKYDSTNLDKYKNFLKEIGYLVEQKEDFKIDTKNIDDEITLQAGPQLVVPV
KNARFALNAANARWGSLYDALYGTDVISKEGDLAITKEYNKKRGEAVVTYAKEFLDESIT
LQKGSYKDVIEFKIVNNELIITLENGETTTLKDKEKFLGFIGEIENPQTLIFKNNNLHIQ
IQIDKNSFIGCLDKAFIKDVILEAAVTTIMDCEDSVAAVDAIDKAEVYKNWFGLMKGDLE
DSFSKNGKIMTRTLNEDITYKTIDGNSKTLHGRSLLFVRNVGHLMTNPAILDENDEEVFE
GIMDCMITVLCSIVDIKGANSKSNSRQKSVYIVKPKMHGPKEVEFTVKTFEMVEDALKLP
RNTIKIGIMDEERRTTLNLKECIRAAKSRVVFINTGFLDRTGDEIHTSMFAGAFVQKSKM
KEQVWIKAYENSNVDIGLECGLQGFAQIGKGMWAMPDEMAKMMVEKINHPKSGANTAWVP
SPTAAVLHSIHYHKVDVFEVQNNLKGDKRASLDELLTLPLMKDISILSKEEIKKELDNNA
QTILGYVVRWIDSGIGCSKVLDINNVALMEDRATLRISSQHLANWIEHKVCTKDDVMDSL
KAMAKVVDVQNTSDLSYINMAPSFDGYAFKAACDLIFEGISQPSGYTEPLLHKYRRELKN
RRILMTN
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaataaaacaaggtaatttaaaaatagaaagaggaatttttgatttaataaat
aatgaaatattaccaaaaacagaaatttcagaaaatgagttttggaaaagttttgaaaat
attatagaaactctaactcctataaataaagagttgctaaaaacaagagatgatttacaa
aaaaagattgataattggtataaaacaaataaatatgattcaactaatttagataaatat
aaaaattttttaaaagaaattggatacttagttgaacaaaaagaagattttaaaatagat
acaaaaaatatagatgatgagataactttacaagctggccctcaacttgttgttcctgtt
aaaaatgcaagatttgctctaaatgctgcaaatgcaagatggggaagtttatatgatgct
ttatatggaacagatgttatatcaaaagagggtgatttagctattacaaaagagtataac
aaaaaaagaggtgaagcagttgtaacttatgcaaaagagtttttagatgaatcaattact
ttgcaaaaaggctcttataaagatgtaattgagtttaaaatagtaaataatgaacttatt
ataactttagaaaatggtgaaacaacaacattaaaagataaggaaaaattcttaggtttt
attggagaaattgaaaatcctcaaacacttatttttaaaaataataatctacatattcaa
atacaaatagataaaaatagttttataggatgtttagataaagcctttataaaagatgtt
attttagaagcagcagttactactattatggattgtgaagattcagttgcagcagttgat
gcaattgataaagcagaagtttataaaaattggtttgggcttatgaaaggtgatttagaa
gatagtttttcaaaaaatggaaaaattatgacaagaactctaaacgaagatataacttat
aaaacaatagatggaaatagtaaaactttacatggaagaagtctgctttttgttagaaat
gtaggtcatcttatgacaaatcctgcaattttagatgaaaatgatgaagaagtttttgaa
ggaattatggattgtatgattactgttttatgctcgattgtagatataaaaggagcaaat
agtaaatcgaactcaagacaaaaaagtgtttatatagttaaaccaaaaatgcacggacca
aaagaggtagaatttacagtaaaaacttttgaaatggttgaagatgctctaaaacttcct
cgaaatacaatcaaaataggaataatggatgaagaaagacgaacaactttaaatctaaaa
gagtgcataagagctgctaaaagtagagttgtatttataaatactggatttttagataga
actggtgatgagattcatacttctatgtttgctggtgcatttgttcaaaaatcaaaaatg
aaagagcaagtttggattaaagcttatgaaaattcaaatgttgatataggtttagagtgt
ggtttacaaggatttgctcaaataggaaaaggtatgtgggcgatgcctgatgagatggca
aaaatgatggttgaaaaaatcaatcatccaaaatcaggagcaaacacagcttgggttcct
tctccaacagcagcagttttacactcaattcattatcataaagtagatgtatttgaagtt
caaaataatttaaaaggggataaaagagcatctttagatgaacttttaactcttccactt
atgaaagatatatcgattttaagtaaagaagagataaaaaaagagcttgataataatgct
caaacaattttaggttatgttgttagatggattgattctggaattggatgttcaaaagtt
ttagatataaataatgtagcacttatggaagatagagcaactttaagaatctcttctcaa
catttagcaaattggattgaacataaagtttgtacaaaagatgatgtaatggactcttta
aaagctatggcaaaagttgttgatgttcaaaatacttctgatttgtcatatataaatatg
gctccatcttttgatggatatgcttttaaagcagcttgcgatttgatttttgaagggatt
tctcaaccatcaggttatactgaaccattattgcataaatatagaagagaattgaaaaat
agaagaattttaatgactaattaa

DBGET integrated database retrieval system