KEGG   Arcobacter sp. L: ABLL_1069Help
Entry
ABLL_1069         CDS       T01834                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
arc  Arcobacter sp. L
Pathway
arc00040  Pentose and glucuronate interconversions
arc00052  Galactose metabolism
arc00500  Starch and sucrose metabolism
arc00520  Amino sugar and nucleotide sugar metabolism
arc01100  Metabolic pathways
arc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABLL_1069
   00052 Galactose metabolism
    ABLL_1069
   00500 Starch and sucrose metabolism
    ABLL_1069
   00520 Amino sugar and nucleotide sugar metabolism
    ABLL_1069
Enzymes [BR:arc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABLL_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: BAK72944
UniProt: G2HUZ1
Position
complement(1094714..1095580)
Genome map
AA seq 288 aa AA seqDB search
MSKENPIKKCLFPAAGYGTRFLPATKATPKEMLPVLTKPLIQYGVEEALAAGMDTMAIVT
GRGKRAIEDHFDISYELEHQIKGTNKEHLLTEIRSVITKCTFSYTRQIEMKGLGHAILCG
ETLIGDQPFAVLLADDLCDAPTQGVLSQMIELYKKYHCSIVAIEEVPKEETNKYGVISGN
EIEPGIYMIKDMVEKPEPEVAPSNLAIIGRYILTPDIFDILKETKPGKGGEIQITDALLT
QAKKGMVLAYKFNGQRFDCGSIDGFVKATNYFYDKETKKEKKKETGAK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaaatccaatcaaaaaatgtctattcccagctgcaggttatggaacaaga
tttttacctgcaacaaaagcaacgccaaaagagatgttaccagttttaacaaaaccactt
attcaatatggagtggaagaagcattagcggcaggtatggatacaatggcaattgtaaca
ggtagagggaaaagagctattgaagatcattttgatatttcttatgaattagagcatcaa
attaaaggaacaaataaagaacatttattgactgaaattagatcagttattacaaaatgt
actttttcatatactagacaaattgaaatgaaaggtttaggtcatgctattttatgtggt
gaaactttaattggagatcaaccatttgcagttttattggcagatgatttatgtgacgct
ccaactcaaggtgttttatctcaaatgattgaactatataaaaaatatcattgttcaatt
gttgctattgaagaagttccaaaagaagaaacaaataaatatggagtaatttctggaaat
gaaattgaaccaggaatttatatgattaaagatatggttgaaaaacctgaacctgaagtt
gctccttcaaatttagcaattataggaagatatattttaactccagatatttttgatatt
ttaaaagaaacaaaaccagggaaaggtggagaaattcaaatcactgatgctcttttaact
caagcaaaaaaaggaatggttttagcttataaattcaatggacaaagatttgactgtgga
agtatcgatggatttgtgaaagctacaaactatttttatgataaagaaacaaaaaaagag
aaaaaaaaagagactggagcaaaataa

DBGET integrated database retrieval system