KEGG   Arcobacter sp. L: ABLL_1069Help
Entry
ABLL_1069         CDS       T01834                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
arc  Arcobacter sp. L
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ABLL_1069
   00052 Galactose metabolism
    ABLL_1069
   00500 Starch and sucrose metabolism
    ABLL_1069
   00520 Amino sugar and nucleotide sugar metabolism
    ABLL_1069
Enzymes [BR:arc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ABLL_1069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1094714..1095580)
Genome map
AA seq 288 aa AA seqDB search
MSKENPIKKCLFPAAGYGTRFLPATKATPKEMLPVLTKPLIQYGVEEALAAGMDTMAIVT
GRGKRAIEDHFDISYELEHQIKGTNKEHLLTEIRSVITKCTFSYTRQIEMKGLGHAILCG
ETLIGDQPFAVLLADDLCDAPTQGVLSQMIELYKKYHCSIVAIEEVPKEETNKYGVISGN
EIEPGIYMIKDMVEKPEPEVAPSNLAIIGRYILTPDIFDILKETKPGKGGEIQITDALLT
QAKKGMVLAYKFNGQRFDCGSIDGFVKATNYFYDKETKKEKKKETGAK
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagaaaatccaatcaaaaaatgtctattcccagctgcaggttatggaacaaga
tttttacctgcaacaaaagcaacgccaaaagagatgttaccagttttaacaaaaccactt
attcaatatggagtggaagaagcattagcggcaggtatggatacaatggcaattgtaaca
ggtagagggaaaagagctattgaagatcattttgatatttcttatgaattagagcatcaa
attaaaggaacaaataaagaacatttattgactgaaattagatcagttattacaaaatgt
actttttcatatactagacaaattgaaatgaaaggtttaggtcatgctattttatgtggt
gaaactttaattggagatcaaccatttgcagttttattggcagatgatttatgtgacgct
ccaactcaaggtgttttatctcaaatgattgaactatataaaaaatatcattgttcaatt
gttgctattgaagaagttccaaaagaagaaacaaataaatatggagtaatttctggaaat
gaaattgaaccaggaatttatatgattaaagatatggttgaaaaacctgaacctgaagtt
gctccttcaaatttagcaattataggaagatatattttaactccagatatttttgatatt
ttaaaagaaacaaaaccagggaaaggtggagaaattcaaatcactgatgctcttttaact
caagcaaaaaaaggaatggttttagcttataaattcaatggacaaagatttgactgtgga
agtatcgatggatttgtgaaagctacaaactatttttatgataaagaaacaaaaaaagag
aaaaaaaaagagactggagcaaaataa

DBGET integrated database retrieval system