KEGG   Arcobacter sp. L: ABLL_1084Help
Entry
ABLL_1084         CDS       T01834                                 

Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
arc  Arcobacter sp. L
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ABLL_1084
   00565 Ether lipid metabolism
    ABLL_1084
   00590 Arachidonic acid metabolism
    ABLL_1084
   00591 Linoleic acid metabolism
    ABLL_1084
   00592 alpha-Linolenic acid metabolism
    ABLL_1084
Enzymes [BR:arc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     ABLL_1084
    3.1.1.32  phospholipase A1
     ABLL_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1112763..1113776)
Genome map
AA seq 337 aa AA seqDB search
MKKFLSLLICSFCLAEDINNIYEEAKKQEELGNYKEAMLLYKKAATLNISKEDTYLFNLK
KNHENEEDRTYTTMKKEFYLKQIDRLDDEETEKSLEQLITKDFNLYPYKKNYLLPVNYSF
NDIEGRKNTETTFQISLEKPISYNFFGLDESISAAYTQKSFWQTTKDSSPFRETNYEPEI
FVTLPYKETSILKAYKFSLLHASNGKNEEESRSWNRLYLEGYFQFSNLFLIPRVWYRIPE
EKGSDDNSDIEDYYGYGDLTLLYAYKKHTFELLLRNNLKLNDSNKGAVELNWTFPLPEFL
STKNTYGLLQLFSGYGNNLIDYDREINKIGIGIVFSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttttatccttattgatatgtagtttttgtttagcagaagatataaataat
atctatgaagaagcaaaaaagcaagaagagttaggaaattataaagaagctatgctttta
tacaaaaaagctgcaacattaaacatttcaaaagaagatacatatctatttaatctaaaa
aaaaatcatgaaaatgaagaagatagaacttatactacaatgaaaaaagagttttaccta
aaacaaatagatagattagatgatgaagagactgaaaaaagtttagaacaacttataact
aaagattttaatttatatccttataaaaagaactatttattgccagtaaattatagcttc
aatgatattgaaggtagaaaaaatacagaaacaacttttcaaataagtcttgagaaacct
atttcttacaatttttttggtttagatgaatcaattagtgcagcttatacacaaaaatct
ttttggcaaacaacaaaagattcttccccttttagagaaactaactacgaaccagagatt
tttgtaacattaccatataaagaaacttctattttaaaagcttataaattttctttatta
catgcttcaaatggtaaaaatgaagaagaatcaagatcttggaatagattatatcttgaa
ggatattttcaattttctaatttattcttaattccaagagtttggtatagaattccagaa
gaaaaaggaagtgatgataattcagatatagaggattattatggatatggagatttgact
ttattatatgcttataaaaaacatacatttgaacttttattaagaaataatttaaaatta
aatgactcaaataaaggtgctgttgagctaaattggacattccctcttcctgaattttta
tcaacaaaaaacacttatggtcttttacaactattttcaggttatgggaataatctaatt
gattatgatagagaaataaataaaattggaataggaatagttttttctagataa

DBGET integrated database retrieval system