KEGG   Arcobacter sp. L: ABLL_1123Help
Entry
ABLL_1123         CDS       T01834                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
arc  Arcobacter sp. L
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1152546..1153424
Genome map
AA seq 292 aa AA seqDB search
MVIYLFAKEPISPIPLNIKVNIEKADLGKELFFDTILSKNNTISCHTCHLLNQGGVDNLQ
FSVGIDGKLGNINAPTVLNSIFNFVQFWDGRAKNLHQQVFGPVTNPVEMDNNFENLITKL
NKTDYKNKFESIYKDGITKNNIADAIAEYEKTLITPNAPFDRYLRGDKNAISDEVKQGYI
LFKTQGCIACHHGINIGGNLYAKFGIVSELKSKSKGRYEVTKNELDEYYFKVPTLRNIEL
TAPYLHDGRIDNLEDTVKFMAHYQLGKSLNEDEVQKIVLFLKSLTGQLYNHE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttggtaatttatctatttgctaaagaaccaatatctccaattcctttaaatataaaggta
aatatagaaaaagcagatttaggaaaagaacttttttttgatactattttgtctaaaaat
aatacaatttcttgccatacttgtcatttattaaatcaaggtggagttgataatctacag
ttttctgttggcattgatggaaaattaggaaatataaatgcacctaccgttttaaactct
atttttaactttgtacaattttgggatggaagagctaaaaatcttcatcaacaagtattt
ggtccagtaactaaccctgttgagatggataataactttgaaaatttaataacaaagtta
aataaaactgattataaaaataaatttgaatctatttataaagatggaattacaaaaaat
aatattgcagatgcaatagcagaatatgaaaaaacattaattacaccaaatgctcctttt
gacagatatttaagaggagataaaaatgcaattagtgatgaagtaaaacaaggatatatt
ttatttaaaactcaaggttgtattgcttgtcatcatggaataaatataggcggaaatcta
tatgcgaaatttggaattgtatctgaacttaaaagtaaatcaaaaggtagatatgaagta
acaaaaaatgagttagatgaatattattttaaagttccaactttaagaaatattgaatta
acagcaccttatttacacgatgggcgaatagataatttagaagatactgtcaagtttatg
gctcattatcaattgggcaaatcattgaatgaagatgaagttcaaaagatagttctattt
ctaaaatctctaacaggacaattatataatcatgaataa

DBGET integrated database retrieval system