KEGG   Arcobacter sp. L: ABLL_1258Help
Entry
ABLL_1258         CDS       T01834                                 

Definition
exodeoxyribonuclease V alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
arc  Arcobacter sp. L
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:arc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABLL_1258
Enzymes [BR:arc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ABLL_1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1283194..1285521
Genome map
AA seq 775 aa AA seqDB search
MQEEYKSFKLSGIIKKVLYKNDETKYIIAVLENNQKICGAYFDTDIEKIVGEEVILKGNW
ITHKKYGVQFEFDTLELKEAEMFFFLTKIVKGVGKKFAHELLEKYSEDELVEILNERPNE
LLDFKGIKDKKLETIVSSWQKFKHLRELGSFLAKFGVTSNLITKIYSSLGEVENLIDKIK
ENPYILINIKGIGFKRADEIAKSLGIDPKSEFRIMACLNYTLREYCDNNGNSSIDKFHLY
KLLDESLRFSNEETLYEQAISKMLVEENIFVTSENRLALSMLYYAEKRILDFFSRRKNEK
NRKIIATFDEYLVKKQQTLGFDLSEEQKKAVELINNGDKTLFLIGYAGTGKSTSSRAILE
LLEEIMSYDDIMTIALSGIASQRISDTTGYNSSTIQSLLVKHKEKDFFPYKAILLDEASM
VNSVTFYQIVSKIDDDTIFIIVGDDGQLPAIGAGNVLADAIKYELAPICKLTKIYRQNEN
QAIAVIANDIRKGELPDYKQEYEDFKFIDVSISNYYSRKNSVSTNEFADLRGENSEYILN
NILNISSTYIQDYYDFIKKKKISKALTLFQVITPMKGGILGVDNLNIQLQKLFNHTKGKA
FVSKIYEYKLTDKVIHIKNENMRAQTMSMYKNASTDFLERRVYNGQLGLIIKLDFDEEKC
IVLYPNDDMVVFYDFENVHHLLSLAYCLTIHKTQGMEYDNALIPMSFSHYIMHNTKLLYT
AITRAKKMCFIVGEEEAFKSACKKLEITIRESVINDLLSKKELNIDSSNIEMISV
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaagagtataaaagttttaaattatctggaattataaaaaaagttctttataaa
aatgacgaaacaaaatacataattgctgttttagaaaataatcaaaaaatttgtggtgca
tattttgatacggatattgaaaaaattgtaggtgaagaagttatattaaaaggaaattgg
attactcataaaaaatatggagttcaatttgaatttgatactttagaacttaaagaagca
gaaatgtttttttttcttacaaaaattgtaaaaggtgttggaaaaaaatttgctcatgaa
cttttggaaaaatattcagaagatgaattagttgagatattaaatgaaagaccaaatgaa
cttttagatttcaaaggaataaaagataaaaaacttgaaactattgtttcttcttggcag
aaatttaagcatttacgtgaattaggttcttttttggcaaaatttggagttacttcaaat
cttattacaaaaatatattcaagtttaggagaagttgaaaatcttatagataaaatcaaa
gaaaatccatatattttaataaacataaaaggaattggatttaaaagagctgatgaaata
gcaaaatctttaggaattgaccctaaatcagagtttagaataatggcttgtttaaactat
actttaagagaatattgtgataacaatggaaattcttcaatagataaatttcatttgtac
aaacttttagatgaaagtttgagattttcaaatgaagaaacgttatatgaacaagcaatt
tcaaaaatgcttgttgaagaaaatatttttgttacaagtgaaaataggcttgctctttca
atgctttattatgctgaaaaaagaattttagatttttttagtagacgaaaaaatgaaaaa
aacagaaaaattatcgcaacctttgatgaatatttagtaaaaaaacagcagactttagga
tttgatttaagtgaagagcagaaaaaagcagttgaacttataaataatggtgataaaacg
ctttttttgataggttatgctggaactggaaaatcaacttcaagtagagcaatactggaa
cttcttgaagaaattatgagttatgatgatattatgactattgcacttagtggaatagca
tctcaaagaataagtgatacaacaggttataattcttcaacaatacaaagcttacttgta
aaacataaagagaaagatttttttccatataaagctattttacttgatgaagcttctatg
gtaaattctgtaactttttatcaaattgtttcaaaaattgatgatgatacaatttttata
attgttggagatgatggacaattacccgcaattggtgctggtaatgtattagctgatgct
ataaaatatgaattagctccaatttgcaaattaacaaaaatttatagacaaaatgaaaat
caagcaatagctgtaattgcaaatgatataagaaaaggtgaattacctgattataaacaa
gagtatgaagattttaaatttattgatgtttctatttcaaattattattcaagaaaaaat
tcagtttctacaaatgaatttgctgatttaagaggtgaaaatagtgaatatattttaaat
aatattttaaatatttcttcaacttatatacaagattattatgattttataaaaaagaaa
aaaatatcaaaagctttgacactttttcaagtaattactcctatgaaaggtgggatttta
ggtgttgataatttaaatattcaacttcaaaaactttttaatcatacaaaaggaaaagct
tttgtatcaaaaatttatgaatataaattaacagataaagttattcatataaaaaatgaa
aatatgcgagctcaaacaatgagtatgtataaaaatgcttcaactgattttttagaaaga
agagtttataacggtcaattaggacttataataaagcttgattttgatgaagaaaaatgt
attgttttatatccaaatgatgatatggttgtattttatgattttgaaaatgtacatcat
ctattatctttagcttattgcttaactattcataaaactcaaggtatggaatatgataat
gctttaattcctatgagtttttctcactatattatgcataatactaagcttttatacact
gcaattacaagagcaaaaaagatgtgctttattgtaggagaagaagaagcttttaaaagt
gcttgtaaaaaacttgaaatcactattagagaatcagttataaatgatttattaagtaaa
aaagagctaaatattgactcttctaatatagaaatgattagcgtttaa

DBGET integrated database retrieval system