KEGG   Arcobacter sp. L: ABLL_1379Help
Entry
ABLL_1379         CDS       T01834                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
arc  Arcobacter sp. L
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ABLL_1379
Enzymes [BR:arc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     ABLL_1379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1393394..1393969)
Genome map
AA seq 191 aa AA seqDB search
MDKDTIKLLSDLSVTMFSKNFFGIYHGAISAKLDQYNFIINTGDAIFDKMDEKSFCSLNI
NKQDYRWNIASIESHIHATIYTNIHEAKYIAFGMPIYTTAYTLKHNKIVFEDFFGKTIFG
EIDIYNPGNFSTWYKRNALEITKYLKESNHNVMIIKGIGTYVYDRDVHELVKKIAILENS
CRLLSIKSSFE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggataaagatacaataaaattactttctgatttatctgtaacaatgtttagtaaaaat
ttttttggtatttatcacggtgcaatttctgcaaaactagatcaatataattttataatt
aatacaggtgatgcaatttttgataaaatggatgaaaaatcattttgttcactaaatata
aataaacaagattatagatggaatattgcaagtattgaatctcatatccacgcaactatt
tatacaaatatacatgaggcaaaatacatagcatttggaatgcctatttatactactgcg
tatacattaaaacataataaaattgtttttgaagatttctttggaaaaactatttttgga
gaaattgatatatacaatcctggtaatttttcaacttggtataaaagaaatgcacttgaa
ataactaaatacttaaaagagtcaaatcataacgttatgataataaaaggaataggtact
tacgtttatgatagagatgttcatgaattggtaaaaaaaatagcaatattagaaaattct
tgtagattattaagcataaagagttcttttgaataa

DBGET integrated database retrieval system