KEGG   Arcobacter sp. L: ABLL_1379Help
Entry
ABLL_1379         CDS       T01834                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
arc  Arcobacter sp. L
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:arc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1393394..1393969)
Genome map
AA seq 191 aa AA seqDB search
MDKDTIKLLSDLSVTMFSKNFFGIYHGAISAKLDQYNFIINTGDAIFDKMDEKSFCSLNI
NKQDYRWNIASIESHIHATIYTNIHEAKYIAFGMPIYTTAYTLKHNKIVFEDFFGKTIFG
EIDIYNPGNFSTWYKRNALEITKYLKESNHNVMIIKGIGTYVYDRDVHELVKKIAILENS
CRLLSIKSSFE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggataaagatacaataaaattactttctgatttatctgtaacaatgtttagtaaaaat
ttttttggtatttatcacggtgcaatttctgcaaaactagatcaatataattttataatt
aatacaggtgatgcaatttttgataaaatggatgaaaaatcattttgttcactaaatata
aataaacaagattatagatggaatattgcaagtattgaatctcatatccacgcaactatt
tatacaaatatacatgaggcaaaatacatagcatttggaatgcctatttatactactgcg
tatacattaaaacataataaaattgtttttgaagatttctttggaaaaactatttttgga
gaaattgatatatacaatcctggtaatttttcaacttggtataaaagaaatgcacttgaa
ataactaaatacttaaaagagtcaaatcataacgttatgataataaaaggaataggtact
tacgtttatgatagagatgttcatgaattggtaaaaaaaatagcaatattagaaaattct
tgtagattattaagcataaagagttcttttgaataa

DBGET integrated database retrieval system