KEGG   Arcobacter sp. L: ABLL_1513Help
Entry
ABLL_1513         CDS       T01834                                 

Definition
putative uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
arc  Arcobacter sp. L
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABLL_1513
Enzymes [BR:arc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     ABLL_1513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1534482..1535114
Genome map
AA seq 210 aa AA seqDB search
MAKIYLLNNQKYSDVENLEVFQIEYIKSKIDLNKYDALIFTSKNAVYSLDSFNKDWKNIP
SYAIALKTANIIKNLGGKISFIGNSGHGNDFAQELIALLKNKKVLYIKALKTVSDLPNIL
RKNEILLDELIAYKTSCKKSTAILEDNSTFIFTSPSSVECFFKQYTWKDSYKAIVIGNTT
AKFLPENVKYEISSLTSIEECINLAKHSFF
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatttatttattaaataatcaaaaatactctgatgttgaaaatttagaagtt
tttcaaatagaatatataaaatcaaaaattgatttaaataaatatgacgccttgattttt
acatcaaagaatgcagtttattctttagattcatttaacaaagattggaagaatatccct
tcttatgcaatagctttaaaaactgcaaatatcataaaaaatttgggtggtaagatttcg
tttattggtaattcaggacatgggaatgattttgcacaagaattaatagctttattaaaa
aacaaaaaagttttatatattaaagctttaaaaactgtatctgatttaccaaatatttta
agaaaaaatgagattcttttagatgaactaatagcatataaaacttcatgtaaaaaatca
actgctattttggaagataattctacatttatttttacttcaccttcgagtgtagaatgc
ttttttaaacaatatacttggaaagattcttataaagcaatagttattggaaatacaaca
gcaaaatttctacctgaaaatgttaagtatgaaattagttctctaacatctattgaagag
tgtataaatctagcgaagcattcctttttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system