KEGG   Arcobacter sp. L: ABLL_1513Help
Entry
ABLL_1513         CDS       T01834                                 

Definition
putative uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
arc  Arcobacter sp. L
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:arc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1534482..1535114
Genome map
AA seq 210 aa AA seqDB search
MAKIYLLNNQKYSDVENLEVFQIEYIKSKIDLNKYDALIFTSKNAVYSLDSFNKDWKNIP
SYAIALKTANIIKNLGGKISFIGNSGHGNDFAQELIALLKNKKVLYIKALKTVSDLPNIL
RKNEILLDELIAYKTSCKKSTAILEDNSTFIFTSPSSVECFFKQYTWKDSYKAIVIGNTT
AKFLPENVKYEISSLTSIEECINLAKHSFF
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaatttatttattaaataatcaaaaatactctgatgttgaaaatttagaagtt
tttcaaatagaatatataaaatcaaaaattgatttaaataaatatgacgccttgattttt
acatcaaagaatgcagtttattctttagattcatttaacaaagattggaagaatatccct
tcttatgcaatagctttaaaaactgcaaatatcataaaaaatttgggtggtaagatttcg
tttattggtaattcaggacatgggaatgattttgcacaagaattaatagctttattaaaa
aacaaaaaagttttatatattaaagctttaaaaactgtatctgatttaccaaatatttta
agaaaaaatgagattcttttagatgaactaatagcatataaaacttcatgtaaaaaatca
actgctattttggaagataattctacatttatttttacttcaccttcgagtgtagaatgc
ttttttaaacaatatacttggaaagattcttataaagcaatagttattggaaatacaaca
gcaaaatttctacctgaaaatgttaagtatgaaattagttctctaacatctattgaagag
tgtataaatctagcgaagcattcctttttttaa

DBGET integrated database retrieval system