KEGG   Arcobacter sp. L: ABLL_1523Help
Entry
ABLL_1523         CDS       T01834                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
arc  Arcobacter sp. L
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:arc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:arc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1546257..1547330
Genome map
AA seq 357 aa AA seqDB search
MYTVLVIDDSPSMRRIIKDMINSIEEFEVIGVATDAYDAREKIKEYEPDLVTIDINMPKM
DGVTFLRNLMRLHPMPAVVISGESVRGNDIFDDGAVGFIPKPDTGESMISFQHRIKDTLL
NLTFLLKRYTLKKPPALKKNYKPTINVEYKVHPDEVIPLRASTFPGMKLIAIGSSTGGVE
SLLKVFKRLPGDLPPILITQHIPYGFSNSFAQRLNDNSEVNVCEAKDGMILERGHGYLAP
GNMHLTIEKYANEYRTKLLDTKKVSQHKPSVDVLFRSVNNAVGGAAMAVMMTGMGDDGTI
AMKELHDNGAYTVAQNEESCVVFGMPMKAIQAGAVKDIVHLDEIADYIIDFSKGKKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtgtatactgttttagttatagatgattcgccatcaatgcgaagaattataaaagatatg
ataaattctattgaagagtttgaagttattggtgtagcaactgatgcatatgatgcaaga
gaaaaaataaaagagtatgaacctgatttagtaacaatagatattaatatgcctaaaatg
gatggtgttacattcttaagaaatttaatgagattacatccaatgcctgctgttgttatt
tcaggtgaaagtgttagaggtaatgatatttttgatgatggagcagtgggttttatacca
aaacctgatactggtgaatcaatgatttcatttcaacatagaataaaagatactctttta
aatttaacatttttattaaaaagatatactttaaaaaaaccacctgctttaaaaaagaat
tataagccaactataaatgtggaatataaagtacatccagatgaagtgattcctcttaga
gcttcaacttttccaggaatgaaattaattgcaattggttcatcaacaggtggagtagag
tctttattaaaagtttttaaacgattacctggagatttacctccaatattaataactcaa
catataccttatggattttcaaactcttttgcacaaagattaaatgataattctgaagtt
aatgtttgtgaagcaaaagatggaatgattttagaaagagggcatggatatttagctcct
ggaaatatgcatcttactattgaaaaatatgctaatgaatatagaactaagttattagat
acaaaaaaagtaagtcaacataaaccaagtgttgatgttttatttagatcagtaaataat
gctgttggtggtgctgcaatggctgttatgatgactggaatgggtgatgatggaacaatt
gccatgaaagaattgcatgataatggtgcatatacagttgcacaaaatgaagagagttgt
gtagtttttggaatgcctatgaaagcaattcaagcaggagctgtaaaagatatcgttcat
ttagatgaaattgcagattacattatagatttttctaaaggaaaaaagaggtaa

DBGET integrated database retrieval system