KEGG   Arcobacter sp. L: ABLL_1567Help
Entry
ABLL_1567         CDS       T01834                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
arc  Arcobacter sp. L
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ABLL_1567
Enzymes [BR:arc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ABLL_1567
Exosome [BR:arc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABLL_1567
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1587105..1588079
Genome map
AA seq 324 aa AA seqDB search
MFKRFRRLRINETLRNLVQETVLTPDDFIYPLFVREGQNIKTEVASMPGVYQMSIDEILK
ECEYLVSINLKSIILFGIPDTKDSVGSECLCGESIIARTIKAIKAKFPQMFIVTDLCFCE
YTDHGHCGILDPKTGSVDNDKTLEISAQQAVVHAKAGADMIAPSGMMDGIITTLRNALDE
NGFKNLPIMAYSTKFASGYYGPFRDVAESTPSFGDRRTYQMNPANRLEAIEESLEDEKEG
ADILMVKPALAFLDIVRDIRNQTNLPLCVYNVSGEYAMLKHAGIAGLIDYERVMMETMIA
FKRAGANIIISYHAKEVCEILRNN
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacgatttagaagattaagaattaatgaaacactaagaaatttagtacaagaa
acagttttaacacctgatgatttcatctatccattatttgtaagagaaggtcaaaatata
aaaactgaagttgcatcaatgcctggtgtttatcaaatgagtattgatgaaattttaaaa
gagtgtgagtatttagtaagtataaatttaaaatcaattattctttttggtattccagat
actaaagattcagttggaagtgaatgtttatgtggggagagtataattgcaagaactatt
aaagcaatcaaagcaaaattccctcaaatgtttatcgtaactgatttatgtttttgtgaa
tatacagaccatggacattgtggtattttagacccaaaaactggaagtgttgataatgat
aaaacattagaaatctctgctcaacaagcagtagttcacgctaaagctggagctgatatg
attgcaccatctggaatgatggatggaattattacaactttaagaaatgcacttgatgaa
aatggatttaaaaatcttccaatcatggcatattcaacaaaatttgcaagtggatattat
ggaccatttagagatgttgctgaatcaactccaagttttggtgatagaagaacttatcaa
atgaatcctgcaaatagacttgaagcaattgaagaatcacttgaagatgaaaaagaaggt
gcagatatacttatggtaaaaccagcacttgcatttttagatattgttagagacataaga
aaccaaactaatcttcctttatgtgtttataatgtaagtggtgaatatgcaatgcttaaa
catgctggaattgctggattaattgactatgaaagagttatgatggaaacaatgattgca
tttaaaagagcgggtgcaaatatcatcatctcttaccatgcaaaagaggtttgcgaaatc
ttaagaaacaactaa

DBGET integrated database retrieval system