KEGG   Arcobacter sp. L: ABLL_1620Help
Entry
ABLL_1620         CDS       T01834                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
arc  Arcobacter sp. L
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:arc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ABLL_1620
DNA repair and recombination proteins [BR:arc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ABLL_1620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1638800..1639372)
Genome map
AA seq 190 aa AA seqDB search
MNKGLEKFYELVEAFESLPTIGKKSALRLAYHIVMNDNYCGIKIAHSIENALKNITKCSR
CGSMSEHEICEFCLDESRDNEKLCIVQSAKDIFVIEDSNQFDGRYFVIEELDQDILDSLQ
KFIIDNGVKNILFAITPSIANDAFILFIEDKLKTYDLKFTKIAQGVPTGVSLENVDILSL
SKAIQSKVEI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaggattagaaaaattttacgaacttgttgaagcttttgaatctttaccaact
attggtaaaaaatcagctctacgtctagcatatcatatagtaatgaatgataattattgt
gggatcaaaattgctcatagtattgaaaatgctttaaaaaatatcacaaaatgttcacga
tgtggatcaatgagtgaacatgaaatttgtgaattttgtcttgatgagagtagagataat
gaaaaactttgtattgttcaaagtgcaaaagatatttttgttattgaagattcaaatcaa
tttgatggaagatattttgtaatagaagagttagatcaagatatattggattctttacaa
aagtttataatagataatggtgttaagaatatactatttgcaattactccttctattgca
aatgatgcttttatcctatttatcgaggataaacttaaaacttatgatttgaaatttaca
aaaattgcacaaggtgttccaacaggtgttagtttggaaaatgtagatattttatcacta
tcaaaagctatacaaagtaaagttgaaatataa

DBGET integrated database retrieval system