KEGG   Arcobacter sp. L: ABLL_1623Help
Entry
ABLL_1623         CDS       T01834                                 

Definition
tryptophan synthase beta subunit
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
arc  Arcobacter sp. L
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ABLL_1623
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABLL_1623
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ABLL_1623
Enzymes [BR:arc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ABLL_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1642041..1643258
Genome map
AA seq 405 aa AA seqDB search
MNKSYLESMPDANGFFGKFGGSFIPPELEKPFEEIKKAYEELKNSPKFIEELKYVRKHYQ
GRPTPVSFAKNLTNFCGGAKIYLKREDLNHTGAHKLNHCMAEVILAKHLGKKKVIAETGA
GQHGVALATAAAYFGLECEIHMGEVDIAKEHPNVVRMKILGAKVIPATHGLKTLKEAVDS
AFEAYLADTKNSIYCIGSVVGPHPFPMMVRDFQSIIGLESREQFLEQEGKLPDAIAACIG
GGSNAMGIFSGFIDDKEVELYGVEPLGKGENIGEHSASLTYGEEGVMHGFNSIMLKDKDG
NPAPVYSIGSGIDYPSVGPEHAYLKESGRSKVGLCDDNEAVEAFYKLSQLEGIIPALESA
HAVGFAMKLAKTLDKEKTILVSLSGRGDKDIDFVINNYPIPNSKF
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatcatatttagaaagtatgcctgatgctaatggtttttttggtaaatttgga
ggttcatttattcctcctgaattagaaaaaccttttgaagaaattaaaaaagcttatgaa
gagttaaaaaattctcctaaatttatagaagaattaaaatatgtaagaaaacattatcaa
ggaagacctactcccgtatcttttgcaaaaaatttaactaacttttgtggaggagcaaaa
atctatctaaaaagagaagatttaaatcacacaggagctcataaattaaaccactgtatg
gctgaagttatacttgctaaacatcttggaaagaaaaaagtaatagctgaaacaggtgca
ggacaacacggtgttgcattggcaactgcagcagcttattttggtttagagtgtgaaatt
catatgggtgaagttgatattgcaaaagaacatccaaatgtagttagaatgaaaattctt
ggagcaaaagtaattccagcaactcatggactaaaaacgttaaaagaagctgttgattct
gcttttgaagcatatttagctgatactaaaaattctatttattgtattggttctgttgtt
ggtcctcatccatttcctatgatggttagagatttccaaagtataattggactagaatca
cgtgaacaatttttagaacaagaaggaaaacttccagatgcaattgctgcttgtattggt
ggtggaagtaatgctatgggaattttttctggatttattgatgataaagaagttgaactt
tatggtgttgagcctttaggaaaaggtgaaaacattggagaacactcagcatctttaact
tatggagaagaaggagttatgcacggatttaactctataatgttaaaagataaagatgga
aatcctgcgcctgtttactcaattggaagtgggattgattatccaagtgttggacctgaa
catgcttatttaaaagaatcaggaagaagtaaagttggactttgtgacgataatgaagct
gttgaagcattttacaagttatctcaacttgaaggaatcattccagcacttgaatcagct
catgctgttggatttgcgatgaaactagcaaaaacattggataaagaaaaaactatttta
gtaagtcttagtggtcgaggggataaagatattgattttgttattaataactaccctatt
ccaaactcaaaattttaa

DBGET integrated database retrieval system