KEGG   Arcobacter sp. L: ABLL_1660Help
Entry
ABLL_1660         CDS       T01834                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
arc  Arcobacter sp. L
Brite
Enzymes [BR:arc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     ABLL_1660
Secretion system [BR:arc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   ABLL_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1688423..1689157
Genome map
AA seq 244 aa AA seqDB search
MFDLTKKMLISSLILTCSLNAATKEVSKAEIAQMEQLELFKRANIQITKAFDVGSIYILS
IKVQGNNDEIYLTKDKKLILSGDVIDVNNGMKVSAPVDLTGVRGKEAFVYGTGKEEYFLF
TDPECPYCKKLESYLPQIKDKVKIRVFYYPLESHENAKDLSLYIMNKKTTNEKIDAMFDA
SENLDKVKNSKYTQTQLAKLEKHLEEQIQIGLNLNVQGTPTIFDKNGNNIVWVNMLEKYG
IEVR
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatttaactaaaaaaatgttaatcagttctcttatcctaacttgtagtttaaat
gctgcaacaaaagaagtatcaaaagctgaaatagctcaaatggaacaattagaactattt
aaaagagcaaatatacaaataacaaaagcttttgatgttggaagtatttatattttaagc
atcaaagttcaagggaacaatgatgaaatttatttaacaaaagataaaaaacttattctt
tcaggtgatgttattgatgtaaataatggaatgaaagtatctgcaccagttgatttaaca
ggagttagaggaaaagaagcttttgtttatggaacaggaaaagaagagtactttttattt
acagatccagaatgtccatattgtaaaaaattagaatcatatttaccacaaataaaagat
aaagttaaaattagagtgttttattatcctttagaatcacatgaaaatgcaaaagattta
tctttatatattatgaataaaaaaacaacaaatgaaaaaattgatgctatgtttgatgca
agtgaaaatttagataaagtaaaaaattcaaaatatacacaaactcaacttgctaaactt
gaaaaacatttagaagaacaaattcaaattggattaaatttaaatgttcaaggaacacca
acaatttttgataaaaatggtaataatattgtttgggttaatatgctagaaaaatatgga
attgaagtaagataa

DBGET integrated database retrieval system