KEGG   Arcobacter sp. L: ABLL_1703Help
Entry
ABLL_1703         CDS       T01834                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
arc  Arcobacter sp. L
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:arc01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:arc00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1730135..1731235)
Genome map
AA seq 366 aa AA seqDB search
MTIIELFQKLLRFKSLTPNDDGAFDFIEEYLGADWTCIKVDMEGVKNRFYYKKFNKNPQH
LCFAGHIDVVPTGEGWSVDPFAADVIDGVITARGSQDMKSGDAAFLYACKNAKNFDGTLS
ILLTSDEEGEGTYGTIKMLEHLKEIDMIPNYAVVAEPTCEVVFGDAIKVGRRGSINGYLT
IQGKQGHAAYPEKGINPVHQIAPLLEKIAGYDLDNGDEYFAPSKLVITDIRAGMQVTNVT
PNKLDLMFNVRNSTNTKKEDVEAYIEKVFGHLNYSLRTTQGSFPFVTNKESKVVKAMENS
IEEILGVKTKHSTAGGTSDARYFGAFGIEAIEFGVINDTIHSVGERTTVKEVEGLTKVFE
NLIEKF
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactattatagaattatttcaaaaattattaagatttaaatcattaactccaaatgat
gatggagcatttgattttatagaagagtatttgggagctgattggacttgtattaaagtt
gatatggaaggtgtaaaaaatagattttattataaaaaattcaataaaaacccacaacat
ctttgttttgcaggtcatatagatgtagttccaacaggagaaggttggagtgttgatcct
tttgctgctgatgttatagatggagttataactgctaggggttctcaagatatgaaaagt
ggagatgctgcttttttatatgcttgtaaaaatgcaaaaaattttgatggaactttatct
attttactaactagcgatgaagaaggggagggaacttatggaactattaaaatgcttgag
catttaaaagagatagatatgattccaaactatgcagttgtagcagagccaacttgtgaa
gtagtttttggtgatgcaataaaagttggaagaagaggaagtataaatggatatttaaca
atccaaggaaaacaaggacatgcggcatatccagaaaaaggaataaatccagttcatcaa
attgcacctcttttagaaaaaattgctggatatgatttggataatggagatgaatatttt
gctccaagtaaactggtaatcacagatataagagcaggaatgcaagtaacaaatgtaaca
ccaaataaacttgatttgatgtttaatgttagaaattctacaaatacaaaaaaagaagat
gtagaagcttatatagaaaaagtttttggacatttaaattatagtttacgaacaacgcaa
ggctcatttccatttgttacaaataaagaatcaaaagttgtgaaggctatggaaaactca
attgaagaaattttaggagttaaaacaaaacatagtactgctggtggaacaagtgatgct
agatattttggagcatttggtatagaagctattgaatttggtgttataaatgatactatt
catagtgtaggggagagaacaactgtaaaagaggttgaaggtcttacaaaagtttttgaa
aatcttatagaaaaattttag

DBGET integrated database retrieval system