KEGG   Arcobacter sp. L: ABLL_1750Help
Entry
ABLL_1750         CDS       T01834                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
arc  Arcobacter sp. L
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ABLL_1750
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    ABLL_1750
Enzymes [BR:arc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     ABLL_1750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1790525..1791625)
Genome map
AA seq 366 aa AA seqDB search
MQKKFLVLFFLCCFGLNNLFANESYSKEDIEKMIAKMVILGFNGENISQKDEIYQNIKVG
LGGVILFDKDPNDKKKVKNVRNKEQLKILTSELQSISKQKLLIGIDQEGGIVQRLKSSDG
FVNTPKASEVALKGESFAKQTYKNLAIDLKESGINLDFAPVVDLAINKENKVIVTRGRSF
GESSKEVIKYSSIFIDELKKEHIISVLKHFPGHGSSLGDSHLGFVDITNTWNQKELEPYK
YLINNGKANMIMTAHVFNEKLDKEYPATLSYNINTNLLRYKLGFDGVLVSDDLQMYAISK
HYDLKQTLTLAINSGVNMLLFANQLAKPITLKEIVDTVYTQILSEQISLETIITANKRID
SLLNKL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaagtttttagttttattttttttatgttgttttggtttgaataatcttttt
gctaatgagagttattcaaaagaagatatagaaaaaatgattgcaaaaatggtgatttta
ggatttaatggggaaaatataagccaaaaagatgaaatatatcaaaatattaaagtaggt
ttaggtggtgttattttatttgataaagatccaaatgataagaaaaaagtaaaaaatgta
agaaataaagagcaattaaagattttaacttcagaacttcaatcaatatcaaaacaaaaa
ttacttattggaattgaccaagaaggtggaatagttcaacgattaaaaagtagtgatggt
tttgtaaatactccaaaagcaagtgaagttgctttaaaaggtgaatcttttgcaaaacaa
acatataaaaatcttgcaattgatttaaaagaatcaggaataaatcttgattttgctcct
gttgttgatttggctataaataaagaaaataaagtaattgtaacaagaggacgttctttt
ggagagagttcaaaagaggttataaaatactcttcaatttttattgatgaattaaaaaaa
gagcatattatttctgtattaaaacactttcctggtcatggttcatctttaggtgattct
cacttaggttttgtggatataacaaatacatggaatcaaaaagagttagaaccatataaa
tatttaattaataatggtaaagcaaatatgattatgacggctcatgtttttaatgaaaaa
ttagacaaagaatatcctgcaacattatcttataatataaatacaaatttattaagatat
aaattaggttttgatggagttttagtaagtgatgacttacaaatgtatgctatttcaaaa
cattatgatttaaaacaaacgttaactttagctataaattcaggagtaaatatgctttta
tttgcaaatcaattagcaaaacctataacattaaaagagattgttgatacagtttatact
caaattttaagtgaacaaatatctttagaaacaataataactgcaaataaaagaatagat
agtttattaaataaattataa

DBGET integrated database retrieval system