KEGG   Arcobacter sp. L: ABLL_1922Help
Entry
ABLL_1922         CDS       T01834                                 

Definition
fatty oxidation complex alpha subunit
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
arc  Arcobacter sp. L
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ABLL_1922
   01212 Fatty acid metabolism
    ABLL_1922
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ABLL_1922
   00650 Butanoate metabolism
    ABLL_1922
  Lipid metabolism
   00071 Fatty acid degradation
    ABLL_1922
   01040 Biosynthesis of unsaturated fatty acids
    ABLL_1922
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABLL_1922
   00310 Lysine degradation
    ABLL_1922
   00380 Tryptophan metabolism
    ABLL_1922
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ABLL_1922
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ABLL_1922
   00281 Geraniol degradation
    ABLL_1922
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    ABLL_1922
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ABLL_1922
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ABLL_1922
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ABLL_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1960039..1962144
Genome map
AA seq 701 aa AA seqDB search
MSNIILEIKQNIATLTFDLKDEKINKLSFEILKEFDEKLNLIKNDISIKALVIDSAKKDI
FIAGADIKEIEKLKDEKEVYDALMEVHDIFNKLENLPIPTIAYINGACMGGGLELALACK
YRVMSTNPKTKIAFPEIKLGIFPGFAGTIRAPKIIGLVNALDLILTGKTIDAKKAYKIKL
ADMIFDDAQKEFMLDDFVKKAIYGTLKERFTFNLLNYAPLNELVFKKAYKNLESKVNKDF
KAPYVALEVIKKTINKEFEDSIKIEAKEFSALAVSKESKNMIKLFFLFEKLNKSYEKTSN
PISNAVVLGNGVMGKGIIYLFSKYLKDVRIKLRDLTQAHEILKDVAKIYDHSIKSRSMSK
NQVDFKLNKISYTDKFLGFKNFDFVIEAIIEDEKVKKETYKELENVIGENTIIATNTSSI
SIEKLGSEIKNKENFLGVHFFNPVNFMPLVEIIPTKQTSKESINKVCEMLISSGKTPIVV
KDCAGFIVNRILLPYLNEAAFILEEGSRIERIDSIIKDFGMPMGPFTLADTVGIDIGYKV
ASILNESYGSRMPIASLIEKMHNAKLLGAKTKAGFYEYAGRDKYPNSHVTSMLENNGRIF
DDEEIVQRCIYIMINEASRCLEENIVTEASIIDFAMIAGTGFPAYKGGLLSYANEIGLKN
ILESLRKFEKEYGERFKPSNLLVKLVEEYEDFETGEALWKH
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattattttagaaattaaacaaaatatagcaacactaacttttgatttaaaa
gatgaaaaaataaataaattatcatttgaaattttaaaagagtttgatgaaaaactaaat
cttattaaaaatgatatttcaataaaagcattagtaattgatagtgcaaaaaaagatatt
tttatagctggtgcagatataaaagagattgaaaaattaaaagatgaaaaagaagtttat
gatgctttaatggaagttcatgatatatttaataaactagaaaatttaccaatcccaaca
attgcgtacataaatggtgcttgtatgggtggaggacttgaacttgcccttgcttgtaaa
tatagagtaatgagtacaaatccaaaaacaaaaatagcatttccagaaataaaactagga
attttcccaggttttgctggaaccataagagctccaaaaatcataggtttagtaaatgcc
ttagatttgattttaactggaaaaacaatagatgctaaaaaagcatataaaatcaaactt
gcagatatgatttttgatgatgctcaaaaagagtttatgttagatgattttgtaaaaaaa
gctatttatggaacactaaaagagagatttactttcaatctattaaattatgctccttta
aatgaacttgtatttaaaaaagcatataaaaatttagaatcaaaagtaaataaagatttt
aaagctccttatgttgctttggaagtgataaaaaagactataaataaagagtttgaagat
tctataaaaattgaagcaaaagagttctcagcacttgctgtttcaaaagaatcaaaaaat
atgataaaactatttttcttatttgagaaattaaataaaagttatgaaaaaacatctaat
cctatttcaaatgctgtagttcttggaaacggagtaatgggaaaaggaattatttattta
ttctcaaaatatttaaaagacgtaagaataaaactaagagatttaactcaagcccatgag
attttaaaagatgtagcaaaaatctatgaccactctataaaatcaagaagtatgagtaaa
aatcaagtggattttaaactaaataaaatctcttatacagataaatttctaggatttaaa
aattttgattttgttattgaagcaattattgaagatgaaaaagtaaaaaaagagacttat
aaagaacttgaaaatgttataggtgaaaatacaataatcgccacaaacacttcatctatt
tctatagaaaaactaggaagtgaaatcaaaaataaagagaatttcttaggagttcacttt
ttcaatccagtaaattttatgcctcttgttgaaataattccaacaaaacaaacttcaaaa
gagagtataaataaagtttgtgaaatgcttatttcaagtgggaaaacaccaattgttgta
aaagattgtgcgggatttatagtaaatagaattttacttccatacctaaatgaagcagca
tttatacttgaagaaggctcaagaattgaaagaattgattcaattataaaagattttgga
atgcctatgggtccatttacgcttgctgatacagttggaattgatattggatataaagtt
gcaagtattttaaacgagtcttatggaagtagaatgccaatagcttctttaatagaaaaa
atgcataacgcaaaacttttaggagcaaaaacaaaagctggattttatgaatatgcaggt
cgggacaaatatccaaactcacatgttacgtctatgctagagaacaatggtagaattttt
gacgatgaagagatagttcaaagatgtatatatattatgataaatgaagctagtagatgt
ttagaagaaaacatcgtaacagaggcttctatcattgattttgcaatgattgcaggaact
ggtttcccagcttacaaaggtggattattaagttatgcaaatgaaattggactaaaaaac
atcttagaatctttaagaaaatttgaaaaagagtatggagagagatttaaaccttctaat
cttttagttaaattggttgaagagtatgaagattttgaaacaggagaagctttatggaaa
cactga

DBGET integrated database retrieval system