KEGG   Arcobacter sp. L: ABLL_2083Help
Entry
ABLL_2083         CDS       T01834                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
arc  Arcobacter sp. L
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:arc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:arc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2131311..2132081)
Genome map
AA seq 256 aa AA seqDB search
MKRLVIKVGTAVLTEDNKKLALERIQNLVNLIAKLKNEKKLEVILVSSGAVGAGYTVLKL
DKKILANKQTLAAIGQPKLMKTYQNMFEKYEISCSQLLFTADDFDSRKRLQNARNVMEIL
LENKVLPIINENDIISTDELIGDNDQLAAFVTYYFKADMLAILTDIDGYYDKNPREYEDA
KLQKNISFISCEELEKKPSANSQFATGGIVTKLKAADFLMQNNIPMYLSSGFDLTNAYDF
LVEGNHKNGTIFQSKK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattagttataaaagttggaactgcagttttaactgaagataataaaaaactt
gcattagaaagaattcaaaatttagttaatttaatagctaaattaaaaaatgaaaaaaaa
ttagaagttattttagtttcatcgggtgctgttggtgctggatatacagtactaaaactt
gataagaaaattttagctaataaacaaacactagcagcaattggtcagccaaaattgatg
aaaacatatcaaaatatgtttgaaaaatatgagatatcgtgttctcaacttctttttaca
gctgatgattttgattcaagaaaaagattacaaaatgctagaaatgtaatggaaatttta
ttagaaaacaaagtacttcctattatcaatgaaaatgatattatctcaacagatgaatta
attggagataatgatcaattagcagcttttgtaacttattattttaaagcagatatgttg
gcaattttaacagatattgatggatattatgacaaaaatccaagagaatatgaagatgca
aaattacaaaaaaacatttcttttatatcttgcgaggaacttgaaaaaaaacctagtgca
aattcacaatttgcaacaggtggaatagtaacaaaacttaaagcagcagattttttaatg
caaaataacattcctatgtatttatcttctggatttgatctaacaaatgcttatgatttt
ttagttgaaggaaatcataaaaatggaacaatttttcaatcaaaaaaataa

DBGET integrated database retrieval system