KEGG   Arcobacter sp. L: ABLL_2146Help
Entry
ABLL_2146         CDS       T01834                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
arc  Arcobacter sp. L
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:arc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2196628..2197200)
Genome map
AA seq 190 aa AA seqDB search
MTKEIEFENAVKKILTHIGEDINREGLIDTPSRVRKAFEFMCSGYKQDPKEIIEKALFTS
TNDEMVVVKDIEFYSQCEHHMLPIIGKAHIAYIPNGKVIGLSKIPRVVDVFARRLQIQEQ
LTEQICDALNEHLKPKGVAVMIDARHMCMEMRGVEKICSTTVTSALRGLFKTNKTTKDEF
LSIVAQSLHK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaaattgaatttgaaaatgctgtgaaaaaaattcttacgcatataggagaa
gatattaatagagaaggattaattgatactccaagtcgtgtaagaaaagcttttgaattt
atgtgcagtggttataaacaagacccaaaagaaataattgaaaaggctctttttacatca
acaaatgatgaaatggttgtggtaaaagatatagaattttattctcaatgtgaacatcat
atgttaccaattattggaaaagcacatattgcttatattccaaatggaaaagttattgga
cttagtaaaattcctagagttgttgatgtttttgcaagaagattacaaattcaagaacaa
ttaactgagcaaatttgtgatgctttaaatgaacatttaaaaccaaaaggtgttgcagtt
atgattgatgcaagacatatgtgtatggaaatgagaggagttgaaaaaatttgttcaact
actgttacatctgctttaagagggctttttaaaacaaataaaacaactaaagatgagttt
ttatcaatagttgctcaatctcttcataaataa

DBGET integrated database retrieval system