KEGG   Arcobacter sp. L: ABLL_2259Help
Entry
ABLL_2259         CDS       T01834                                 

Definition
(GenBank) phosphohexosemutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
arc  Arcobacter sp. L
Pathway
arc00010  Glycolysis / Gluconeogenesis
arc00030  Pentose phosphate pathway
arc00051  Fructose and mannose metabolism
arc00052  Galactose metabolism
arc00230  Purine metabolism
arc00500  Starch and sucrose metabolism
arc00520  Amino sugar and nucleotide sugar metabolism
arc00521  Streptomycin biosynthesis
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
arc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABLL_2259
   00030 Pentose phosphate pathway
    ABLL_2259
   00051 Fructose and mannose metabolism
    ABLL_2259
   00052 Galactose metabolism
    ABLL_2259
   00500 Starch and sucrose metabolism
    ABLL_2259
   00520 Amino sugar and nucleotide sugar metabolism
    ABLL_2259
  Nucleotide metabolism
   00230 Purine metabolism
    ABLL_2259
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ABLL_2259
Enzymes [BR:arc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     ABLL_2259
    5.4.2.8  phosphomannomutase
     ABLL_2259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: BAK74134
UniProt: G2HYD1
Position
2320220..2321629
Genome map
AA seq 469 aa AA seqDB search
MISKTIFRQYDIRGIVNVDLTYENAKLIGYYLGLHIKEKTKTMPYIVVGYDVRTHSQMLF
NGLISGINLSGCKVLNIGLVATGVNYFASFQEFLINNEKIKPTASIMITGSHNAKKYNGF
KITINNEPFFGDELLALYEKIAKNTNIQIPDNFDFFEIDAKNLYIDFMVKQFSHLKDFKI
PFIVDCGNGVANTVLCDILDKLNLNYKGIHLNPDGEFPNHHPDPTNEKNLEDLKALLIDD
YNLGFAYDGDADRIAVLTQKYNIKGDMLALLFSKTMKNPVIIGEVTYSQNIFEELNHEAK
TIMNKTGYSNLRLKLKELNADLAAEVSGHIFFNDRYYGYDDAIYATFRVLELLYEGINLD
VELDKLPKVYTSSNIEINVNEKDKFLIIKKIDEKLKTIQRGFPIIKDIVKIDGLRINFEY
GFALIRASNTNSVIVTKYEATSYATAVSYKVAVENILNEVINEINSTTN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgataagcaaaacaatttttagacaatatgatattcgtggcatagtaaatgttgattta
acctatgaaaatgccaaattaattggttattatctaggacttcatataaaagaaaaaaca
aaaactatgccatatatagttgttggttatgatgtaagaactcactctcaaatgcttttt
aatggattgatttctggaattaatctctcaggttgtaaagttttaaatattggtctagtt
gcaactggagttaactattttgcctcttttcaagaatttttaataaacaatgaaaaaata
aaaccaacagcttcgattatgattacgggaagtcataatgccaaaaaatataatggattt
aaaatcactataaataacgaaccattttttggtgatgaacttttagctttatatgaaaaa
atagcaaaaaatacaaatatacaaattccagataattttgatttttttgaaattgatgct
aaaaatttatatatagattttatggttaaacagttttctcacctaaaagattttaaaatt
ccttttattgttgattgtggaaatggagttgcaaatactgttttatgtgatattttagat
aaattaaatctaaattataaaggaattcatctaaatccagatggagagtttccaaatcat
catccagacccaacaaatgaaaaaaatctagaagatttaaaagctttattgattgatgat
tataatttaggttttgcctatgatggagatgcagatagaattgccgtgttaactcaaaaa
tataatataaaaggcgatatgttagccctacttttttcaaagactatgaaaaatccagtt
attattggagaagtaacatattcacaaaatatttttgaagagttaaatcatgaagcaaaa
acaattatgaataaaactggttattcaaatttaagactaaaactaaaagagttaaatgct
gatttagcagctgaagtttcaggacatatattttttaatgatagatattatggttatgat
gatgcaatttatgcaacatttagagtattagaacttttatatgaaggaataaatcttgat
gttgaactagataaacttccaaaagtttatacaagttcaaatattgaaataaatgtaaat
gaaaaagataaatttttaatcataaaaaaaatagatgaaaaactaaaaactattcaaaga
ggttttcctataatcaaagatatagttaaaattgatggtcttagaataaattttgagtat
ggttttgctttgattcgtgcttcaaacacaaattctgttattgtgacaaaatatgaagct
acaagttatgcaacagctgttagttataaagttgcagtcgaaaatattttaaatgaggta
ataaatgaaattaatagcactacaaattaa

DBGET integrated database retrieval system