KEGG   Arcobacter sp. L: ABLL_2579Help
Entry
ABLL_2579         CDS       T01834                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
arc  Arcobacter sp. L
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABLL_2579
Enzymes [BR:arc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     ABLL_2579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2671784..2672560)
Genome map
AA seq 258 aa AA seqDB search
MKNEMIEKSYAKVNIFLKIADKRENYHELVSRFVRVHNLYDIISFVKSSRKAITIIGNFG
CKMDSNTVYKAYNLIKHFKGVEEFFLNHEIRIEKNIPEFAGLGGGSSNAATFLIMANKYC
KLNLSKDELSKIGAQVGADVPFFVYEYDSANVTGIGEIVEKFDEEILDIKTLTPKIKCNT
GEIFKIFREKFYKQISKEEAKKLLDMKSIDILKELDIKEANDLYESALSLYPQLSEFEKK
DWYFSGSGSSFFRINNGK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaaatgattgaaaagtcgtatgctaaagtaaatatttttctaaaaattgca
gataaaagagaaaattatcacgaactcgtatcaagatttgtacgagttcataatttgtat
gacattatatcatttgttaaatctagtaggaaagcaattacaattataggaaattttggt
tgtaaaatggattcaaatactgtatataaagcatacaatttgataaaacattttaaaggt
gttgaagaattctttttaaatcatgaaattagaatagaaaaaaacattccagagtttgca
ggacttggtggcggaagttcaaatgcagctacatttttaattatggcaaataaatattgt
aaattaaatttatcaaaagatgaattaagtaaaataggtgcacaagttggtgctgatgtt
ccattttttgtttatgaatatgatagtgcaaatgtaacaggaattggagaaatagtagaa
aaatttgatgaagagattttagatataaaaactttaacaccaaaaataaaatgtaataca
ggtgaaatttttaaaatatttagagaaaaattttataaacaaatatcaaaagaagaagca
aaaaaattgcttgatatgaaatcaattgatattttaaaagagttagatataaaagaagca
aatgatttatatgaaagtgcactaagtctttatccacaacttagtgaatttgaaaaaaaa
gattggtattttagtggaagtggaagttcattttttaggataaataatggcaaataa

DBGET integrated database retrieval system