KEGG   Arcobacter sp. L: ABLL_2601Help
Entry
ABLL_2601         CDS       T01834                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
arc  Arcobacter sp. L
Brite
Enzymes [BR:arc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ABLL_2601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2693531..2694556)
Genome map
AA seq 341 aa AA seqDB search
MKLAISLTVCLLGASTLLAAETLITKAKNSGLEAIPTDNAKLMKMIDDKKDPITKEKVEL
GKKLYFDPRLSRSGLISCNTCHNLALGGADGVPAAIGHGWTANPHHLNSPTVYNSVFFKA
QFWDGRSPHLADQAQGPVQAGPEMAAPPSLVEQRINSIPEYVEEFKGAYGKEVKVDFAKI
TATIATFEKTLVTPSRFDKFLSGDEKALSKEEKEGLNTFIDKGCTACHTGIALGGTMQAF
QVASQYKFMNVGDFKGDANGMVKTPTLRNITETAPYFHNGQIWSLNEAVKEMGSVQLGIK
ISDADAQKIVTFLKSLKGDKPEIIYPQLPESTIETEKPTFN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcaatttctttaacagtttgtttattaggtgcaagtacattgttagcagca
gagactttgataacaaaagcgaagaatagtggactagaagcaataccaacagataatgca
aaattaatgaaaatgatagatgataagaaagatccaataacaaaagagaaagtagaatta
gggaaaaaattgtactttgacccaagattatcaagaagtggattgatatcatgtaataca
tgtcataatcttgcattaggtggagcagatggagtgccagcagcaataggacatggatgg
acagcaaatccacatcacttaaattcaccaaccgtgtataattcagtgttctttaaagca
caattttgggatggaagaagcccacacctagcagatcaagcacaaggaccagtacaagca
ggaccagagatggcagcgccaccatcattagtagaacaaagaataaactcaataccagaa
tatgtggaagagtttaaaggtgcatatggaaaagaagtaaaagtagattttgcaaaaata
acggcaacaatcgcaacattcgagaaaacattagtaactccatcaagatttgataaattc
ttaagtggagatgaaaaagcattaagtaaagaagaaaaagaaggattaaatacatttatt
gataaaggatgtacagcatgtcatacaggaatagcattagggggaacaatgcaagcattc
caagttgcctcacaatacaaatttatgaatgtaggggattttaaaggtgatgcaaatgga
atggtaaaaacaccaacattaagaaatataacagagacagcaccatatttccataatgga
caaatatggtcattgaatgaagcagtaaaagagatgggttctgttcaattaggtattaaa
atttctgatgctgatgctcaaaaaattgtaacattcttaaaatcattaaaaggtgataaa
ccagaaataatatatccacaacttccagaatctacaatagaaactgaaaaaccaactttc
aactaa

DBGET integrated database retrieval system