KEGG   Arcobacter sp. L: ABLL_2607Help
Entry
ABLL_2607         CDS       T01834                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
arc  Arcobacter sp. L
Pathway
arc00010  Glycolysis / Gluconeogenesis
arc00051  Fructose and mannose metabolism
arc00562  Inositol phosphate metabolism
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc01120  Microbial metabolism in diverse environments
arc01130  Biosynthesis of antibiotics
arc01200  Carbon metabolism
arc01230  Biosynthesis of amino acids
Module
arc_M00002  Glycolysis, core module involving three-carbon compounds
arc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:arc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABLL_2607
   00051 Fructose and mannose metabolism
    ABLL_2607
   00562 Inositol phosphate metabolism
    ABLL_2607
Enzymes [BR:arc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ABLL_2607
Exosome [BR:arc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ABLL_2607
  Exosomal proteins of bladder cancer cells
   ABLL_2607
  Exosomal proteins of melanoma cells
   ABLL_2607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BtpA
Motif
Other DBs
NCBI-ProteinID: BAK74482
UniProt: G2HZN3
Position
complement(2701034..2701744)
Genome map
AA seq 236 aa AA seqDB search
MPIIASNFKTNHTRKSTAIFVNEVNDYLKEKNILSEVYVFPTATSLDIFDTVSNFIIGTQ
NAYATASGSFTGEIGTVQLDEFEIKTILIGHSERRHILGETQNVIAQKYEFYKNLGYKII
YCIGEPLEIKQKGIKSTLEYIYEQFIGIDINYENLILAYEPVWAIGTGVSATNNDIENVH
NAIKEKINKPLLYGGSVKSENVREICQIPNVDGVLIGTASWKVEEFIKIIENTKDL
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcctataattgcaagtaatttcaaaacaaatcatacaagaaaatcaacagctatattt
gtaaatgaagttaatgattatttaaaagaaaaaaatattttaagtgaagtttatgtgttc
cctacagctacttcacttgatatttttgatacggtttcaaattttattataggaactcaa
aatgcttatgcaacagcaagtggttcttttactggtgaaattggaactgttcaacttgat
gaatttgaaattaaaacaatactgataggacatagtgaaagaagacatattttaggtgaa
acacaaaatgtaatagctcaaaaatatgaattttataaaaatcttggatataaaataatt
tattgtattggtgaacctttagaaattaaacaaaaaggaataaaatctactttagaatat
atttatgaacaatttattggaattgatataaattatgaaaatttgattcttgcttatgag
cctgtttgggctataggaacgggagtttctgcaacgaataatgatatagaaaatgttcat
aatgcaataaaggaaaaaatcaataaaccacttttatatggtggaagtgttaagtcagaa
aatgtaagagaaatatgtcaaattccaaatgtagatggagttttaataggaacggcttct
tggaaagttgaagaatttataaaaataatagaaaatacaaaggatttatag

DBGET integrated database retrieval system