KEGG   Arthrospira platensis: NIES39_A00860Help
Entry
NIES39_A00860     CDS       T02608                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
arp  Arthrospira platensis
Brite
Enzymes [BR:arp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     NIES39_A00860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86217..88484
Genome map
AA seq 755 aa AA seqDB search
MGWMRYIAMALVNTLGVVVGIILVPAPHAVAQLAAETEGPVEYKIWELETRLSEYGRTSS
SLDRLETVRENPQSVAQLYELRDRLQAQLDQVSGPPDPLVVQEAWQYELQLQQYQSWRQA
LRQTESRIRNEEKASQHWKQASQLALEAVEIGKYPNPTVKDWEMAQQLWIGAIDSLRQIP
ADSLIQPQAIDKIVEYQGYLAIVTYQRALASQPEAEPTATTGEIAQFSVAEPKFPGFALH
ADVNRDGVIDALDKMRPSQWSLSAGPLILFNNDDDDRSGIPDSHDRIVNGEYDEADLAQI
HFKISEEYQDADIYISVDEASRRRINMFQKTIGGWKYIDLSGASPLEFSPTIILGVEAKQ
FADGQWSGLVNVKAIARKNDTEIASDQIQMGVAPWIMSPNTAPVSQVHISDRGVNQDVVE
ALQDAIAPTGTPTRITPGETVWMRDSTAIGYVQFPSPDGLRQYNVALSPPGGGDYARSLL
GRNFGWAEIGEPREIDSPNQWLDFYGNLNVTPPLPGYPMGRIYYGKADGETINPDILAFL
EAQQVQWPPVEIDTSWLITRQVDELITFVPTASGKPLMLVVSPQEGVNLLRQLAQTGYEG
AAINRSLSTQTTVRAALNNELLIQHNLRLHRDKITPLINQLKEEFKLNDEQIVEVPAMFG
YTGYAWWPNPVNSVFVNGKLLVSDPRGALIDGRDYTQEDLQRRLAIAGLEITFLDDTYYQ
NLRGSLNAGLNTTRIGEEQAFWESFTQQLGQFSQR
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggggtggatgcggtacatagcgatggcattagtcaatacattgggcgttgtggtgggg
attatcttagtacccgcgcctcatgcagtggctcaactagcagcggagacagaggggcct
gtagaatataagatctgggaattggaaactcgcttatcggaatatggcagaacttcctct
agcttagatcgcttagaaacagtgcgggaaaatccccaatctgtggctcaattatatgaa
ttacgcgatcgcctacaagcccaacttgaccaagtatctggcccccctgaccccctggta
gttcaggaagcctggcaatatgaactacaactgcaacaatatcagagttggcggcaagcc
ctacgccaaaccgaaagccgcattcgtaacgaagaaaaagccagccaacactggaaacaa
gcctcccaattagcactcgaagcagtcgaaattggcaaatatcctaaccccaccgtcaag
gattgggaaatggcacaacagttgtggataggtgcgatcgactccttgcgacaaattccc
gcagatagtttaattcaaccccaagccattgacaaaattgttgaataccagggctattta
gccattgtcacctatcaacgagccctagctagtcaaccagaagctgaaccgaccgctact
acaggagaaattgctcagttttctgtcgctgaacccaagtttcccggttttgctctccat
gctgatgttaaccgagatggggtaattgatgctctcgacaaaatgcgccctagccaatgg
tcattatctgctggacccttaattctgtttaataatgatgatgacgatcgcagtggtatt
cccgacagtcacgatcgcattgttaatggcgaatatgatgaggcagatttagcccaaatt
cactttaagatttccgaagaatatcaagacgcagatatatatattagcgttgatgaagcc
tcccgccgccggattaatatgttccagaaaactattggcggctggaaatatattgatttg
tccggtgcttctcccctggaatttagccctactattatcctcggtgtggaagctaaacaa
ttcgctgatggtcaatggagtggcttggtcaatgtcaaagcgatcgcccgtaaaaatgac
acagaaatcgcctctgaccaaatccaaatgggtgtcgcaccttggattatgtctcctaat
accgcccccgtttcccaggtacatataagcgatcgcggtgtgaatcaagacgtagtagaa
gccctacaagatgcgatcgctcccaccggaacccccacccgtattaccccaggagaaacc
gtctggatgcgagatagcaccgccattggctatgtacaatttcccagtcctgatggtttg
cgtcaatacaatgtagctttaagtccccctggcggtggtgattatgccagatccttatta
gggcgaaattttggttgggctgaaataggagaaccccgcgaaattgactccccaaatcaa
tggttagatttctatggcaaccttaatgttaccccacctcttcccggctatcctatgggg
cgtatttactacggaaaagccgacggcgaaactatcaatcccgatattttagccttttta
gaagcccaacaagttcagtggccccccgtagaaattgacacatcttggttaattactcgc
caagtagatgaactaattacatttgttccgacagcatcaggtaaacccttaatgctagtc
gttagtccccaagaaggggtaaatttattgcggcaattagcccaaaccggttacgaaggc
gcagcaattaatcgcagtttaagcacccaaaccacagtgagagccgccctgaataatgaa
ctattaattcagcataatttgaggttgcatcgtgacaaaatcacccctttaattaatcag
ttaaaagaggaatttaaacttaatgatgagcaaattgtggaagtcccagccatgtttggt
tataccggatatgcttggtggccgaacccggttaattcggtgtttgtcaatggcaaatta
ttggtgtctgacccgcgaggggctttgattgatggccgagattacacccaggaagacttg
cagcgaagattagcgatcgctggtcttgagatcacatttttagatgatacttattaccaa
aacctccgaggtagtcttaacgctggtttaaatactaccagaatcggagaagaacaggct
ttctgggaatccttcacccaacagttaggacaatttagccaacgctaa

DBGET integrated database retrieval system