KEGG   Arthrospira platensis: NIES39_A07770Help
Entry
NIES39_A07770     CDS       T02608                                 

Definition
probable carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
arp  Arthrospira platensis
Brite
Enzymes [BR:arp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     NIES39_A07770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
755814..756611
Genome map
AA seq 265 aa AA seqDB search
MSEHLPYFSGFESLAVQWTDKIWSRGVPFWLRAEPKSNRVVLCLHGFTATPFEVRPVAQA
CLSRGLDGVGPLLPGHGFQELADQKLFFPKMTAEGMLSAVRRELELARSHYEFVGIFGHS
MGGAIALKMAAEGRVDACAVTAPALKLPPRAVILLALFGWANISIPTQPKPFDNPVYLFD
NCPAGRALQQLARIARSDLSSITCPVLAIHSHRDDLVSPVVINWMEKQLPDNLDVRWFDD
SGHVMILDVNGEEISQAIADFFSQF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacatctgccatatttttcgggttttgagtctttagcagtccagtggacagac
aaaatctggtcaaggggtgtaccgttttggttgcgggctgaaccgaaatcaaatcgggta
gttttgtgtttacatgggtttacggccactccttttgaggtaagaccagtagcgcaagcc
tgtctgagtcgggggcttgatggggtggggcctttgttacctggtcatggttttcaagag
ttagcagaccagaagttattttttccgaaaatgacagcggaaggaatgttatctgctgtg
cgtcgggagttagaattagcccgatcgcattatgaatttgtcggtatttttgggcattct
atgggaggggcgatcgctttaaaaatggcagcggaagggcgagtagatgcctgtgctgtc
actgcaccggccttaaaattaccgcctcgggctgtgattttattggctttatttggttgg
gcgaatatttctatccccactcagcccaagccttttgataaccccgtttatttatttgat
aattgtccggcggggcgggcgctgcaacaactagcgaggatagcccgatcagatttatct
tcaattacttgtccggtgttagctattcattcccatagggatgatttagtcagtccggtg
gtaattaattggatggaaaaacaactaccagacaatttagatgtccgttggtttgacgat
tcgggtcatgtcatgattttagatgttaatggcgaggaaattagccaggcgatcgccgat
ttttttagccaattctag

DBGET integrated database retrieval system