KEGG   Arthrospira platensis: NIES39_D05340Help
Entry
NIES39_D05340     CDS       T02608                                 

Definition
glycoside hydrolase, family 13
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
arp  Arthrospira platensis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NIES39_D05340
Enzymes [BR:arp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     NIES39_D05340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2116090..2117853
Genome map
AA seq 587 aa AA seqDB search
MKPMRSTDSDYQYFCVRLQPLLEIAYEPATIPSILDRLFAVIGDNLYIPNGNENPNKWTE
NNVTLITYGDSICSRDTDQKPLEVLAKFLGEHLQDTITGVHILPFFPYTSDDGFAVSDYL
SVNRELGDWEDIKTIASQFNLMVDVVLNHVSSKHQWFQQFQAGEKPGSDYFIVVEPETDL
SEVVRPRNSPVLVKVETVHGEKHVWATFSEDQIDVNFANPDVLIEFLKIIRFYIVNAKAR
YIRLDAVGFMWKEIGTSCIHLPPTHAIIKLLRELVNMIDPEVALITETNVPNRENLSYFG
NRNEAHMIYNFSLPPLLLNAMLQGKSDHLKTWMMSMPPAPLGCAYFNFTASHDGIGLRPA
EGLLSDDEYQSLLTTMEKLGGKISMRKKPDGSESPYEINISLFDAMKGTVKGEDTWQIQR
FICSQTLMMSLEGIPAFYIHSLLATPNDYDRLKETGMNRSINRYKWQIEDLQKDLENPHS
PRSLVFREICRRIKIRRQQGAFHPNATQYTLQLKRSLFGFWRQSMTRDQSIFCIFNLTDK
PQQLNLRDVNLICIDPWLDLISGEMITDIYSKYILQPYQAVWITNKF
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatgcgatcgactgatagtgattatcaatatttttgtgtgcgtctccagccc
ttactagaaattgcctacgaacctgccacaattccgagtattttagaccgtctatttgcc
gtaattggcgacaatttatatataccaaacggcaatgaaaaccccaataaatggacagaa
aacaacgtcacattaatcacctatggcgatagtatttgtagccgggatactgaccaaaaa
cccctagaagttttggcaaaatttttaggagaacacctgcaagataccatcaccggggtg
catattttacccttttttccctatacctcagatgatggatttgccgtcagtgactattta
agcgttaatcgggaactcggagactgggaagatatcaaaaccattgctagtcaatttaac
ttaatggtagacgtagtgcttaatcatgtttccagtaagcaccaatggttccaacaattc
caagccggagaaaaaccaggctctgattattttatagtggttgaacccgaaaccgaccta
tcagaagttgtcagaccccgcaacagtcccgtattagtcaaagtagaaactgtccatgga
gaaaagcacgtttgggcaacttttagcgaagatcagattgatgttaattttgccaatcct
gatgtcttaattgagtttttgaaaatcatcagattttatatagtgaatgccaaagccaga
tatattcgcctagatgctgtgggttttatgtggaaagaaatcggcacatcttgcattcat
ttacccccaacccatgccattattaaactactgcgggaactggtaaatatgatagatcca
gaagtagctttaattaccgaaaccaacgtaccaaaccgggaaaatctcagctattttggc
aatcgaaatgaggcgcacatgatttataactttagcttgccgccactgttgttaaatgcg
atgcttcagggtaaatcagaccatctcaaaacctggatgatgagtatgccacccgccccc
ctaggctgtgcttattttaattttacggcttcccatgatggcattggtttacgtccggcc
gagggtttactttccgatgatgaatatcaaagcctgttaaccactatggagaaattaggc
ggtaaaattagcatgaggaaaaagccagatggtagtgagagtccctatgaaattaatatt
tccttatttgatgccatgaaaggcacagttaaaggagaagatacctggcaaattcaacgc
tttatttgttcccaaactctgatgatgtctttagaggggattccggcattttatattcat
agtttattggctactcccaatgattatgacaggttaaaagagacgggaatgaatcggtca
attaatcgctataagtggcagattgaggatttacaaaaggatttagagaacccccattct
cctcgatcgcttgtattccgcgaaatctgtcggcgcattaaaatccgtcgccaacagggt
gcttttcatcctaacgccactcaatacaccctacaattaaagcgatcgctatttgggttt
tggcgacaaagtatgaccagagaccaaagcattttctgtatctttaatctgaccgataaa
ccccaacaactcaatttaagagatgtcaacctgatctgtatagatccttggttagattta
atcagtggggaaatgattaccgatatttactccaagtacatcttacaaccctatcaagcc
gtgtggattaccaacaaattctag

DBGET integrated database retrieval system