KEGG   Arthrospira platensis: NIES39_D07470Help
Entry
NIES39_D07470     CDS       T02608                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
arp  Arthrospira platensis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:arp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NIES39_D07470
   00330 Arginine and proline metabolism
    NIES39_D07470
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NIES39_D07470
Enzymes [BR:arp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     NIES39_D07470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2336814..2337734
Genome map
AA seq 306 aa AA seqDB search
MNTQARLSLNLVQLETWVEAAKSRSDQGSLPTYIPQLAMVSPKAFAVQVLDCQGNCYLLG
NADLRFSLMSVVKPFLLLYMLVELGADRIFAQVGMEPSDYPFNSLEQLQADGGWPRNPMI
NSGAIALSALLPGPDGQTRCQVLSDWLNHWGGCSLQLDYDTLNSVRSAPNSRNDAITTEL
YHRGTISDAIAAIDAYNHICCLSATVEDLAKLGMLLLQPPQPSWIEPCRQVKALMMTCGL
YEASSRFAVQVGVPTKSGVSGVMLSVIPGWGAIACYSPPLDDTGNSVAGLFLIQEIVRSL
NLSIFN
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcaggcaagattgagtttaaacctggtgcaactagagacatgggttgaagcg
gctaagtctcgcagcgatcaaggcagtttaccgacctatattcctcagttagctatggta
tctccaaaggcattcgcagttcaagttttagattgccaggggaactgttatttattgggc
aatgctgatctgagattttccctaatgagtgtggttaagccgtttctgctgttgtatatg
ttggtagagttgggggccgatcgcatatttgcacaggtgggaatggaaccctctgattat
cccttcaattctctggaacaattgcaagctgacggcggctggccccgtaatccgatgatt
aatagtggcgcgatcgctttatcggcgttgcttcctggtcctgatggacaaacacgatgc
caagtgttatctgattggttaaatcactggggcggctgttctctgcaattggattatgat
accctcaattctgtgcgttccgcccccaattctcgtaatgatgccatcaccaccgaatta
tatcaccgggggactatttctgatgcgatcgctgccattgacgcttacaatcatatttgt
tgtttatctgccacagtcgaagatctagctaaattggggatgttattattgcagcctcct
caaccgagttggatagaaccctgtagacaggtgaaagcattgatgatgacctgtggctta
tatgaagcctctagtcgatttgcggtacaggtgggagtccctactaagtcgggagtcagt
ggggtgatgctatcggtgattcccggttggggggcgatcgcttgttatagtcctcccctt
gatgataccggaaattcagtagcgggtttatttttgattcaggaaatagtgcgatcgctt
aatctgagcatttttaactga

DBGET integrated database retrieval system